KEGG   Serratia proteamaculans: Spro_0324
Entry
Spro_0324         CDS       T00595                                 

Definition
(GenBank) conserved hypothetical protein
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: DUF2859 DUF4780
Other DBs
NCBI-ProteinID: ABV39434
UniProt: A8G8J4
Position
376536..377060
AA seq 174 aa
MKKVNFLLFGLSLVTTAALANLNVIADVGGEDASPYFEGINRQEGAQSSPVAPPAPASPA
DTEAAVLPVATPELTPGDVADRPLQLPGIGALFIVGDDDDSRIWLKANAEQLKSRHAAGL
VVNVSNLPALQALRELAPGVPMAPASGSELARRLQLAHYPVLITDTGLSQQVSP
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaaaaaagtgaattttctgctgttcggcctgagtctggtgaccaccgcggcgctggcc
aatctgaatgtgatcgccgatgtcggtggtgaagatgcttcgccgtattttgaaggtatc
aaccgccaggagggggcacaatcgtctcccgtcgcgccgccggcgccggcatctcctgct
gataccgaggctgcagtgttgcctgtggcaacgccagaactgacgccaggtgatgtggct
gacagacctctgcagttacccgggatcggcgcgctgtttattgtgggtgatgacgacgac
agccgtatctggctaaaggcgaacgcggaacaactcaaatcccggcacgccgcaggtctc
gtcgttaacgtcagtaacctgcctgcactgcaggcgctgcgtgagctggcaccgggtgtg
ccgatggcgcccgcatccggcagtgaactggcgcgtcgtctgcagttggcgcattacccg
gtgctgatcaccgataccgggttgtcacaacaggtctcaccatga

DBGET integrated database retrieval system