KEGG   Serratia proteamaculans: Spro_0329
Entry
Spro_0329         CDS       T00595                                 

Definition
(GenBank) plasmid conserved hypothetical protein RAQPRD
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: Plasmid_RAQPRD
Other DBs
NCBI-ProteinID: ABV39439
UniProt: A8G8J9
Position
381523..381855
AA seq 110 aa
MRIPVVTRGLGAGFLLGLSFLIALPALAAEKDELASAQRMLVQVQAALERARVAAVQADP
SERGRFFFDYARATADLKTINAGIDRYLEPSRAQPRDGSAVAGNYHRERP
NT seq 333 nt   +upstreamnt  +downstreamnt
atgcgtatccccgtagttacccgaggactgggcgccggctttttgctggggctgtcattc
ctcatcgcactgcctgccctggctgctgaaaaagatgagctggcatctgcccagcgcatg
ctggttcaggtgcaggcggcgcttgaacgcgcgcgcgttgccgccgttcaggccgacccg
tccgagcgtggccgtttcttctttgactatgcccgcgccactgccgacctcaagacaatc
aatgccggtattgaccgttacctcgaaccctcgcgcgcgcaaccgcgtgatggcagcgcg
gtggccggtaattaccaccgggagcgtccctga

DBGET integrated database retrieval system