KEGG   Serratia proteamaculans: Spro_0337
Entry
Spro_0337         CDS       T00595                                 
Name
(GenBank) putative plasmid-related protein
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG HerA_C SfsA FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: ABV39447
UniProt: A8G8K7
Position
386535..389393
AA seq 952 aa
MRFSLFDKKRLTRKTPAVPATGDQDTVIATEDGVPLSVDGREPLRRPGKMTVKDEKQVYH
ANPSIVDYLPWAEFLDREQCILLDDGVSVGAVFEITPVATEGRTDDRLEQMRDTVEDALQ
DSFDEHDENPWVVQFFCQDENNVDAYLDRLRGYIKPHAQGSQLSESWLKETERHMRGIAR
PEGLFKDTLITDQPWRGQQRRTRMVVYRWIGKGNTDPMPPIAMLNQTCERVTGALNGAGV
VCVRQNGGQVHDWLLRHFNPSPEWVDKETLYRDAAYFDSRDTPEGAMPVQNDFAETLLFT
PPVSDPDQGVWWFDNQAHCAIPVEKLRRPPEPGTLTGEQKRGEKKINALMDMFPEGTMVC
MTIVVQPQDTLETDFNKLSKNAVGENTESGRVRQDVAQVKEYLGNRHKLYRAGITFLLRA
GDLTTLNHKCVDLTNVLLGAGLQPVRPEFDVAPLNTYLRALPMCFNPETDKKHWYTRLTW
VQHLAGLLPVTGRETGTGNPGLSFFNRGGDILTVDPLNKHDRSQNAHMLYFGPTGAGKSA
TLCATLTQTMAVHRPRLFIAEAGNSFGLLADYFESQGLTVNKISIKPGSGVSLPPFSFAH
KLIEELSSLELDESELRDIDADDEDEDKRDYLGEMEISARMMITGGDQKEEAELKRADRA
MIREALLMAAKSAFDEQRQMLPSDLQNALYAISNDTANEKRNPQRRAKAAEMAEALGMFT
QAGSFEAELFNREGSLWPEADVTLIDLGHLAREGYEAQMALTMVSLTNTINNIAERDQYS
ERDIVFAVDEAHIVTVNPLLAPYMTKIVKMWRKLGAWLWLATQNLKDFPDIAEKMLNMAE
WWVCLTMPPEEVNDIARFKALTEEQKAVLLSASKLSGCYTEGVVLSKKLEALFRAVPPSL
YLALGMTEKEEKAERRALMHEFGCSELEAARKVAQKLDRLRGLAANGEAAVA
NT seq 2859 nt   +upstreamnt  +downstreamnt
atgcgattttccctgtttgataaaaagcgcctgacgcgcaagacgccggcggtgccggct
acgggtgaccaggacacagtgatcgccaccgaggacggcgtgccgctgtccgttgacgga
cgtgaaccgttacggcgcccgggcaagatgacggtaaaggatgagaagcaggtgtatcac
gccaatccgtccatcgttgattacctgccctgggcggagtttctcgaccgtgagcagtgt
attttgctggatgacggggtgtccgtcggggccgtattcgaaattacaccggtggccacc
gaagggcgcacggacgatcgcctggagcaaatgcgcgacacggtggaagacgcgctgcag
gactcgtttgacgagcatgacgaaaacccctgggtggtgcagttcttttgccaggatgag
aacaacgtcgatgcgtatcttgaccggctgagagggtatatcaagccgcatgcgcagggc
tctcaactgtctgaatcctggctgaaagaaaccgagcgccatatgcgcggtattgctcgt
ccggaaggtctgttcaaagacacgctgatcaccgatcagccatggcgtgggcagcaacgc
cgtacccgcatggtggtgtaccgctggattggcaagggcaacaccgacccaatgccgcct
atcgccatgctgaatcagacctgtgagcgcgtgacgggggcgctgaacggggcaggtgtg
gtgtgtgtgcggcaaaatggcggccaggttcacgactggctgctgcgtcattttaatccc
agccctgagtgggtggataaagagacgctgtaccgtgacgccgcctattttgacagccgt
gacacaccggaaggcgccatgccggtgcagaacgattttgccgaaaccctcctgttcacc
ccacccgtgtccgatccggaccagggggtgtggtggttcgataatcaggcgcattgcgcc
attccggtcgagaagctgcgccggccgccagagccgggcaccctcaccggtgagcagaag
cgtggcgagaagaaaatcaacgcgctgatggatatgttcccggaagggacaatggtctgc
atgaccatcgtggtgcagccgcaggacacgctcgaaaccgactttaacaagttgtccaag
aacgccgtcggtgagaataccgaatccgggcgcgtgcgtcaggacgtggcacaggtcaag
gaatacctgggtaatcgtcacaagctgtaccgtgccggcatcaccttcttgttgcgtgcc
ggcgacctgaccacgctcaatcacaaatgtgtcgatctgaccaacgtgctgctcggcgcg
ggcctgcaaccggtacggccggagtttgatgtggcgccgctcaatacctacctgcgggcg
ctgccgatgtgttttaacccggagacggacaagaaacactggtacacccgcctgacctgg
gtacagcacctggcggggttgctgccggtgaccgggcgtgaaacgggaacgggcaatccc
ggactgagttttttcaaccgcggtggcgatattctgacggttgacccgctcaacaagcat
gaccgcagccagaatgcccatatgctgtattttggcccgaccggcgcagggaagtctgcg
acattgtgtgccacgctgacgcaaaccatggcggtacatcggcctcgtctgttcattgct
gaagcgggcaactcgtttggattgttggctgattactttgaaagccaggggctgacggtc
aataaaatcagcatcaaaccgggcagtggtgtgtctctgccgccgttctctttcgcgcat
aagcttatcgaggaactgagttcactggagctggatgaaagtgagttgcgtgatatcgat
gcggacgacgaagatgaggataaacgcgattatctgggggagatggagatctcggcgcgc
atgatgatcactggcggtgaccagaaggaagaagcggagttaaaacgggctgaccgggca
atgatccgcgaagccttgctgatggcggcgaaaagcgcctttgacgaacagcgccagatg
ttaccgtctgatttgcagaacgccttgtacgctatttctaacgacacggccaacgaaaag
cgcaatccacagcgtcgggcgaaagcggccgaaatggcggaagcgctgggcatgtttacc
caggcaggcagcttcgaggcggagttgtttaaccgtgaaggtagcctgtggccagaggcg
gatgtcaccctgattgacctagggcatctggcgcgtgaggggtatgaggcgcagatggcg
ctgacgatggtgagcctgaccaacaccatcaacaacattgccgagcgggaccagtactcg
gagcgggacatcgtgtttgcggtggatgaagcgcatatcgtgacggtgaacccgctgctg
gcaccgtatatgaccaaaatcgtcaaaatgtggcgtaagctcggcgcctggctgtggctg
gcgacacagaacctgaaagacttcccggacattgccgaaaagatgctgaacatggcggag
tggtgggtctgtctgacgatgccgccggaggaggtcaacgacattgcccgcttcaaggcg
ctgaccgaggaacaaaaagcggtgctgctgtcagccagtaagctgtccggctgttatacc
gaaggtgtggtgttgtcgaaaaaactcgaggcgctgttccgtgcggtaccaccgagcctg
tacctggcgctggggatgaccgagaaagaagagaaggccgagcgccgcgcgctgatgcac
gaatttggctgcagcgagctcgaggcagcccgcaaagtggcgcaaaagcttgaccgcctg
cgtggcctggcggcgaacggagaggcagcggtagcatga

DBGET integrated database retrieval system