KEGG   Serratia proteamaculans: Spro_0340Help
Entry
Spro_0340         CDS       T00595                                 

Definition
(GenBank) ornithine cyclodeaminase/mu-crystallin
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
spe  Serratia proteamaculans
Pathway
spe00998  Biosynthesis of secondary metabolites - other antibiotics
spe00999  Biosynthesis of secondary metabolites - unclassified
spe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    Spro_0340
   00999 Biosynthesis of secondary metabolites - unclassified
    Spro_0340
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     Spro_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABV39450
UniProt: A8G8L0
Position
390902..391936
Genome map
AA seq 344 aa AA seqDB search
MSDGQVDFEVITGDYINKVIATSRRDIIDLVRQSYLTHHQGKTENPDSYFLRFKNKPEAR
IIALPAAIDNPEADTSVSGIKWIASYPRNIEANLQRASAVILLNDYETGYPFSCLEASQI
SAARTAASAVLAANHLGPAGKNAKRLSIIGGGLIARTILAFFKDEGWRFDDVVIHDISAE
YRDAFIKNTNLQEVYQVRAAVDQAEALAADIVVFATTAASPHVMDERTFAPHQLVLNISL
RDVSPEIVHAGNNVLDDVEHCMKANTSPHLAEQKYGHRCFINGTLAQVINGEITLDKTKA
TLFSPFGLGVLDLSLAMFIYRCNRVAPGRHIIPDFFPDTQRWSL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggacaggtagattttgaggtcatcacaggcgattatatcaacaaggtcatt
gccacgtcccgccgggacattatcgatctggttcgccaaagttacctgacccatcatcag
ggaaaaaccgagaatccagacagctattttttgcgttttaaaaacaaaccggaagccaga
atcattgctctgccagcggccatcgacaaccccgaggctgacacttccgtttccggcatc
aaatggatcgccagctatccgcgcaatatcgaagccaacctgcagcgcgcatcggcggtt
attttgttgaacgattatgagacgggatatccgttctcatgcctggaggcatcgcaaatc
agcgcggcgcgtactgccgcttctgcggtactggcggccaatcaccttgggccagccggc
aaaaacgccaagcgtttgtccatcatcggcggcggtctgatcgccagaaccattctggcc
tttttcaaggatgaggggtggcgtttcgatgacgttgtgatccatgacatttctgccgaa
tatcgcgatgcatttatcaaaaacaccaacctgcaagaggtgtatcaggtgcgggcggcg
gtcgatcaagcggaagcgctggccgcggacattgtcgttttcgccaccacggcggcgtcg
ccgcatgtcatggatgagcggaccttcgcgcctcatcaattggtgctcaatatttccttg
cgcgatgtgtctccggagatcgttcacgctggcaacaacgtgctggacgatgttgaacat
tgcatgaaggccaacacctcacctcaccttgccgagcaaaaatatggccaccgctgcttt
atcaacggcaccctggcgcaagtcatcaacggtgagataacgctcgataaaaccaaagcc
actctcttttctccctttggtctgggcgtgctcgatctgagcttggccatgtttatttac
cgctgtaatcgcgtagcacccggcaggcatatcatccccgatttcttccccgacacgcag
cgctggagcctttaa

DBGET integrated database retrieval system