KEGG   Serratia proteamaculans: Spro_1157Help
Entry
Spro_1157         CDS       T00595                                 

Definition
(GenBank) Lysophospholipase
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
spe  Serratia proteamaculans
Pathway
spe01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Spro_1157
Enzymes [BR:spe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Spro_1157
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Spro_1157
Lipid biosynthesis proteins [BR:spe01004]
 Fatty acid synthase
  Component type
   Spro_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL OSK
Motif
Other DBs
NCBI-ProteinID: ABV40261
UniProt: A8GAX1
Position
complement(1273131..1273721)
Genome map
AA seq 196 aa AA seqDB search
MGLFSLRAVAADTLLILGDSLSAGYRLPVAQAWPTLLADQWQKKPGDPQLVNASISGDTA
AQGLARLPELLKQHQPRWVLIELGANDGLRGFPAQDLQRDLSQIITLVQQAGAQPLLMQI
RIPPNYGRRYTEAFSAIYPQLAKQFDIPLLPFYMEQVVVKAEWMQDDGLHPNKDAQPFIA
TWMAERLEPLVKHESN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttgggattattcagtttacgcgctgtcgccgccgataccttattgatattaggcgacagt
ttaagcgccggttaccgcttgccggtggcgcaagcctggccgacgctgctggccgaccaa
tggcagaaaaaaccgggtgacccgcaactggtcaacgccagcatcagtggcgataccgcc
gctcaggggctggcacgtctgcccgagctgctgaaacaacatcagccacgctgggtactg
attgaactgggtgccaacgacggtctgcgcggtttcccggcgcaggatctgcaacgcgac
ctcagccaaatcatcacgctggtgcaacaagccggcgcgcagccgctgctgatgcaaatc
cgtattccgcccaactatggccgccgctataccgaggccttcagtgcgatttacccgcag
cttgccaaacaattcgacattccactgctgccgttctatatggaacaggtggtggtgaaa
gcggaatggatgcaggatgacggattgcatcccaataaggatgcccaaccgtttatcgcc
acctggatggcggaacgcctggaacctctagtaaaacatgagtctaactaa

DBGET integrated database retrieval system