KEGG   Serratia proteamaculans: Spro_1615Help
Entry
Spro_1615         CDS       T00595                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
spe  Serratia proteamaculans
Pathway
spe00340  Histidine metabolism
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01230  Biosynthesis of amino acids
Module
spe_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Spro_1615
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Spro_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh FdhE SIP
Motif
Other DBs
NCBI-ProteinID: ABV40719
UniProt: A8GC79
Position
complement(1769195..1770502)
Genome map
AA seq 435 aa AA seqDB search
MSNFNTLVNWADCSAEQRTALLMRPAISASDSISRTVSEILDNVKANGDQALREYSAKFD
KTEVGALRVTAEQITAASARLGDEIKQAMAIAVANVETFHNAQKLPPVDVETQPGVRCQQ
VTRPIDSVGLYIPGGSAPLFSTVLMLATPARIAGCRRVVLCSPPPIADEILYAAQLCGVE
EVFQVGGAQAIAAMAFGTDSVPRVAKIFGPGNAFVTEAKRQISQRLDGAAIDMPAGPSEV
LVIADAGATPAFVASDLLSQAEHGPDSQVILLTPEAAMAQAVRDAVEQQLAQLPRAETAR
QALASSRLIVTKDLAECVAISNQYGPEHLIIQTRDARALVDSITSAGSVFLGDWSPESAG
DYASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELTPQGFMNLAATIETLAAAEQLIAH
KNAVTLRVAALKEQA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacttcaatactctggtcaactgggcagactgcagcgccgaacagcgcacggca
ctgctgatgcgtccggcgatctccgcctcggacagcatcagccgcacggtgagcgaaatc
ctcgacaacgtgaaggccaatggcgatcaggcgctgcgcgaatacagcgctaaatttgat
aaaaccgaagttggcgcactgcgcgtcaccgcagagcaaataacggctgccagcgcgcgt
ctgggcgatgagatcaagcaggcaatggcaattgcagtcgccaacgtggaaaccttccac
aatgcgcaaaaactgccgccggttgatgtggaaacccagccgggtgtgcgttgtcagcag
gtaacccgtccgatcgactcggttgggctatatattccaggcggttctgctccgctattt
tctacggtgttgatgctggcgacaccggcacgcatcgccggttgccgccgcgtagtgctg
tgttcaccgccgccgattgccgatgagatactgtatgccgcacaactgtgtggagtggaa
gaggtgtttcaggttggcggtgcgcaggcgatcgccgctatggcattcggtaccgactcc
gtaccgcgcgtggcaaaaatcttcgggccgggcaatgcctttgtcaccgaagccaaacgc
cagatcagccaacgactggacggtgccgccatcgatatgccggccggcccttccgaagtg
ctggtgatcgccgacgccggtgccactccggcattcgtcgcctcggatctgctgtcacag
gcggagcacggcccggactcgcaggtgattttgttgacaccggaagccgcgatggcgcag
gcggtacgcgatgccgtagaacagcaactggcacaattaccccgcgccgaaactgcacgt
caggcgctggccagtagccgactgattgtcaccaaagatttggccgagtgcgtggccatc
agcaatcagtatggcccggaacacctgatcattcagacccgcgacgcccgcgctctggtc
gacagcatcaccagcgccggttcggtgtttcttggcgactggtcaccggagtctgccggt
gactatgcgtccggcaccaaccacgtgctgccaacctatggttacaccgccacctgctcc
agtttggggctggcggacttccaaaaacgcatgacggtacaagagttgacgccgcagggc
tttatgaacctggccgccaccattgaaaccctggccgccgccgagcagttgattgcccac
aaaaacgccgtgaccctgcgcgttgccgccctgaaggagcaagcatga

DBGET integrated database retrieval system