KEGG   Serratia proteamaculans: Spro_1753
Entry
Spro_1753         CDS       T00595                                 

Definition
(GenBank) protein of unknown function DUF1047
  KO
K09911  uncharacterized protein
Organism
spe  Serratia proteamaculans
Brite
KEGG Orthology (KO) [BR:spe00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Spro_1753
SSDB
Motif
Pfam: MatP MatP_C RHH_4 cIII CcdA
Other DBs
NCBI-ProteinID: ABV40857
UniProt: A8GCL7
Position
1932638..1933096
AA seq 152 aa
MKYQQLENLESGWKWKYLVKKHREGEAITRHIENSVAQEAIDELLKLENEPVKVLTWISH
HMNPELDNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAALARRRGVTLSETVV
QLIEDAERKEKYASQMSSLKQDLKAILGKDKE
NT seq 459 nt   +upstreamnt  +downstreamnt
atgaaatatcagcaactggaaaatctggagagcggttggaaatggaagtacctggtgaaa
aagcaccgggaaggggaagctattacccgccacattgaaaacagcgttgctcaggaagcc
attgacgagctgctgaagctggaaaatgagccggtaaaagtgctgacgtggattagccac
catatgaatccggaactggataaccggatgaagcaaactatccgcgcacggcgtaaacgt
cattttaacgcagaacaccaacatacgcgtaaaaaatctatcgatctggagtttctggtt
tggcagcgtttggccgcgctggcccgtcgccgtggggtgactctatcagaaacagtggtg
cagttgatcgaagatgcggaacgtaaagagaagtatgccagccagatgtcatcattgaag
caagatttaaaagctattctcggtaaagacaaagaataa

DBGET integrated database retrieval system