KEGG   Serratia proteamaculans: Spro_1798Help
Entry
Spro_1798         CDS       T00595                                 

Definition
(GenBank) ImcF domain protein
  KO
K11891  type VI secretion system protein ImpL
Organism
spe  Serratia proteamaculans
Pathway
spe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:spe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Spro_1798
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:spe02044]
    Spro_1798
Secretion system [BR:spe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Spro_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C B_lectin
Motif
Other DBs
NCBI-ProteinID: ABV40901
UniProt: A8GCR1
Position
1977765..1980968
Genome map
AA seq 1067 aa AA seqDB search
MGEASSRPVKKKITPRLPLKADISSHLRRRYNLFWRSKVRLLLVTGDENAIAQLVPNLQA
LQWLEGNRTVLIYGGSLTSEPDEKKYTSLRKLRRGRPLDGIVRVIGEGQSITPQMSDSDL
RGLEKISELLRYSAPVWLWQLCDSNWLQATRSEQAVGASFPQHANADDVTSQLELLLPAL
RAQGVSQVAENNSRDFLLRLGQHLKDGGIARWAQQLVPWLSASQQRVPLRGLMFSLPENK
PTDTSEGTAGAAFADAEKYVPESQCHALTLPVTWQGIVEDCTRVRGRRVGMAWEQTLAWG
IMAALGIWGTGLLLSFALNYSHISSVANKARSLVEHPSVSDSQLTALHDLRNDAGRLQHH
VQGGSPWYQRFGLDHNPQLLSAMLPWYGVANNRLIRDPANAALMQKLTALTNSAPNSDQR
AQLAKSGYDQLKAWLMMSRPDKVDGAFYAQTMQRVQPTRQGISTGLWQSLAPDLWAFSIS
GLLEQPQWKITLDTALVSQSRQVLLQQIGRRNAEGTLYENMLKSVRRNFADVSLEDMTSG
TDARRLFSSDDVVPGMFTRQAWEGGIQQAIEKAANSRRDEIDWVLSDSRKTVSADLSPEA
LKARLTQRYFTDFAGSWLNFLNSLRLNPAHNIADVTDQLTLMSDVRQSPMIALMNTLAWQ
GQAGELREGLSDSIIKSAKDLLGSEDKPVIDQRAAGPQGPLDDTFGPLLTLMGKNQASNL
MSADSTLSLQTYLTRITRVRLRLQQVASANDPQEMMQALAQTVFQGKSVDLTDTQQYGSL
VAASLGEEWSGFGNTLFVQPLTQAWETVLQPSAASLNARWSRSVVANWHTAFEGRFPFAA
SKSDASLPMLAEFIRKDTGRIDRFLTAELSGVLHKEGSRWVPNRTNSQGLTFNPAFLKAL
NQLSQLSDILFTDGSQGISFELQARPVPQVVETQLTIDGQQLHYFNQMADWQSFRWPGDT
FKPGAMLTWTSTSAGTRLFGDYSGTWGFIRWLEQGKRKQLDRSQWMMSFTAPDGRTLQWV
LRSQLGKGPLALLALRGFRLPEQIFSVDAATAQALTGTENSAMEGME
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atgggagaggcttcttccagaccggtcaaaaagaaaataacgccccggctgccgctcaag
gcggacatcagcagccatctccgtcgccgctataacctcttctggcgaagtaaagtccgc
ctgctgttagtcacaggcgatgaaaacgccatcgctcagttggtgcccaacctgcaagcc
cttcagtggctggaaggtaaccgcacggtcttgatttacggcggcagcctgacctctgaa
cccgacgaaaaaaaatacacctccctgcgcaagctgcgacgtggtcgtcctctggacggc
atcgtgcgcgtaattggcgaaggccagagtattacgccgcagatgagcgatagtgatctg
cgcggtctggaaaaaatcagcgaactgctgcgctattccgccccggtttggctgtggcaa
ctgtgtgacagcaactggttgcaggcgacgcgctctgaacaggcggtaggggcaagcttt
ccgcaacacgctaatgcagacgatgttaccagccagcttgagctgctgctgccggcgcta
cgggcccagggcgtgagccaggtcgctgagaacaacagccgcgactttctgctgcgcctg
ggccagcaccttaaagacggcggtattgcccgttgggctcagcaactggtgccatggctc
tctgcctcccagcagcgcgttccgctgcgtggcctgatgttcagcctgccggagaataaa
cccactgatacgtcagagggaacagccggcgctgcatttgccgacgctgagaaatatgtt
cctgaatcacaatgtcatgcgctgaccctgccggtgacctggcagggtattgttgaagac
tgcacccgtgtgcgtggccgccgtgtcggtatggcctgggagcagacgctggcatggggc
attatggctgcgctcggtatctggggcaccgggctgctgctctcttttgccctgaactat
agtcatatttcttctgtagcgaacaaagcccgttctctggtcgagcatccctctgtttct
gactctcaactgacggccctgcatgacctgcgtaacgatgccggccgcttgcaacatcat
gttcagggcggttcaccctggtaccagcgctttgggcttgaccataacccgcaactgttg
agtgcgatgctcccgtggtatggcgtggcgaacaaccgcctgatccgcgacccggccaat
gctgccctgatgcagaaactgactgcgctgacaaattcggcacctaacagcgaccagcgc
gcacagctggcgaaatccggttatgaccaactgaaagcctggttgatgatgtcccgcccg
gacaaagtggatggcgcgttctacgcccaaacaatgcaaagggtgcaacccacccggcag
gggatttccaccggattgtggcagagccttgcgccagacttgtgggcgttctctatatct
gggttgctggaacagccccagtggaaaatcaccctggatacggcgctggtcagccagagc
cgccaggtgctgttgcagcagattggtcgccgtaatgcggagggaaccctctacgaaaac
atgctcaaatcggtgcggcgtaactttgccgatgtgtcactggaagacatgaccagtggg
accgatgcccgccgtctgttctccagcgatgacgtggtgccggggatgttcacccgtcag
gcctgggaagggggcattcagcaggccatcgagaaagcggcaaactcgcgccgggatgaa
attgactgggtgttgagcgacagtcgcaagaccgtttctgccgacctttctccggaagcg
ctgaaagcgcgtctgacgcagcgttatttcactgattttgccggcagctggttgaacttc
ctcaacagcctgcggctgaatccggcgcacaacattgcggatgtgactgaccaactgaca
ttgatgagcgatgtgcgtcagtcgccgatgattgcgctgatgaatacgttggcctggcag
ggacaagccggcgagctgcgcgaagggctgtcggattccattatcaagtcggcaaaagat
ctgctcggtagtgaggataagcccgttatcgatcagcgtgcagccgggccgcagggaccg
ctggatgacactttcgggccgctgctaaccctgatggggaaaaaccaggccagcaaccta
atgtcggccgacagcacgctgagcctgcaaacctacctcactcgtatcacccgtgtgcgt
ctgcgcctgcaacaggtggcgagtgctaacgatccgcaggagatgatgcaggccctggca
cagaccgtattccagggcaaaagtgtggatctgaccgatacccagcagtacggcagcctg
gtggcggccagtttgggtgaggaatggagcggttttggcaacaccctgtttgtgcagccg
ctgacgcaggcctgggaaaccgtactgcaaccgtctgcagccagcctgaacgcccgctgg
agccgttcagtggtagcaaactggcataccgcctttgaggggcgcttcccgtttgccgcg
agcaaaagcgacgcttccctgccgatgctggcggagtttatccgcaaggacaccgggcgt
atcgaccgtttcctgaccgctgaactcagcggcgtgttgcataaagaaggcagcaggtgg
gtgccgaaccgtactaacagccaggggctgacgtttaacccggcatttctgaaagcgtta
aatcagctgagccagttatccgacattctgtttaccgacggcagtcagggcatcagcttc
gaattacaggcccgcccggtaccgcaggtggtggaaacccagctaacgattgacgggcag
cagttgcattacttcaaccagatggccgactggcagtccttccgctggccgggggatacc
ttcaagcccggcgcgatgctgacctggacttcaaccagcgccggtacacgtctgttcggg
gattacagtggcacctggggcttcattcgctggctggagcagggcaagcggaaacagctt
gatcgcagccagtggatgatgagttttaccgctccggatggtcgcacgctgcagtgggtt
ctgcgttcccaactgggcaaagggccgctggcgttgctggcgttacgcggtttcaggctt
cctgagcagatattcagcgtggatgccgccactgcacaggcgctgaccggcacagagaat
tcagccatggaggggatggaataa

DBGET integrated database retrieval system