KEGG   Serratia proteamaculans: Spro_1800
Entry
Spro_1800         CDS       T00595                                 

Definition
(GenBank) protein of unknown function DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
spe  Serratia proteamaculans
Brite
KEGG Orthology (KO) [BR:spe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:spe02044]
    Spro_1800
Secretion system [BR:spe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Spro_1800
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABV40903
UniProt: A8GCR3
Position
1982588..1984342
AA seq 584 aa
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKSGARDPYVERLFEGFAFLMGRL
REKLDDDLPELTEGLVSLLWPHYLRTIPSMSVVEFTPDWREMKEQMRIAKGFEVLSRPIG
EKGTRCRYTTTQELNLQPLSLEQARLATDADGRSVVTLRFNCSNLADWSRIDFSSISLYF
NADAPLACAMHAAFTLNVARMWLRMPGDIDRRPLDGHFTAQGFGDDDALWPKGSSSFSGY
QLLLEYFTFREKFMFTGLRGLESVAFPAALPWFEIDVVLAERWEHDFSFTEKHLRLNCVP
VINLFPLESDPLALNSLQTEYMLRPMRVQDGHTEIYAVDSVTSSSQHTYVPFSSFRHKGG
MMRHQAPEYYYHTRVRRGPSGLHNTWLILGGEAFDHHTVPEDESLSLTLTGTNGQLPRRT
LQSTVLDTVMKTTSTSIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSGFLSMMDNADVLR
GTLALYEWTDSEMNRRRLEAIIDVKHSETERFEQGYLVRGVQIEVTLDSHGFAGRGDICL
FGEMLSRFFALYTDIYLFNRLIIILQPTGERLEWEEKHNRRIPG
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggacgacttaaccctgcgttattacgacgccgaaatgcgctacctgctggaagctggt
gaagagtttgcccgcgctcatcctgagcaggcggcgatgctgaacctcgataaatctggc
gcccgcgacccctatgtggagcgtctgtttgaaggctttgccttcctgatgggccggctt
cgcgaaaagcttgacgacgatttgccggagctgaccgaagggctggtcagcctgctgtgg
ccgcattacctgcgcaccattccttccatgtccgtggtcgaattcacgccggactggcgc
gaaatgaaagagcagatgcggatcgccaaaggtttcgaggtgttgtcgcgtccgatcggc
gaaaaagggacgcgctgccgttacaccaccacccaagagctcaaccttcaaccgctgtcg
ctggagcaggccagactggccaccgatgcggatggtcgctcggttgtcacgctgcgtttt
aattgcagtaatttggcagactggagccgtatcgatttcagcagtatttcactttacttc
aacgccgatgcgccgctggcctgcgccatgcacgccgcctttaccctgaatgtggcccgg
atgtggctgcggatgccgggcgatatagacagaagaccgctggatgggcatttcaccgcg
cagggctttggcgatgacgatgccttatggccaaaaggcagtagcagtttcagtggctac
caactgctgctggagtacttcaccttccgcgagaaattcatgttcaccggcctgcgaggg
ctggagagcgtcgcctttccggctgcgctcccctggtttgaaatcgatgtggtgctggct
gaacgttgggaacatgacttcagctttaccgaaaagcatctgcgccttaactgcgtgccg
gttatcaacctcttcccgctggagtctgatccgctggcgctgaactccctgcaaacagaa
tacatgctgcgcccgatgcgcgtgcaggacggccacaccgagatttacgccgtggattcg
gtgacgtcatccagtcagcatacctatgtgccgttctccagttttcgccacaaaggcgga
atgatgcgccaccaagcgccggaatattactaccacacccgcgtacgccgtggcccttcg
gggctgcacaacacctggctgatcctcggtggcgaagcctttgaccatcacactgtgccg
gaagatgaaagtctgtcgctgacgctcaccggcaccaatggccaactgccacgacgtacg
ctgcaaagtaccgtgcttgatacggtgatgaaaaccacctcgaccagcatcgccgtgcgc
aacctgtgtgcgccaacgcttccctgttacccaccggcgcaggaccggtttcactggcgc
gtgctgagccacctcggcagcgggttcctctcgatgatggataacgccgacgtgctgcgc
ggtactctggcgctgtatgagtggacggacagcgagatgaaccgccgtcgcctggaggcc
atcatcgacgtgaagcacagcgaaaccgagcgcttcgagcagggctatctggtgcgcggc
gtgcagattgaagtgaccctcgacagccacggctttgccggtcggggcgacatctgcctg
tttggcgaaatgctgagccgtttctttgccctctataccgatatttacctgtttaaccgc
ctgattatcattctgcaaccgaccggagagcgtctggaatgggaagagaagcacaaccgc
cgcattcccggctga

DBGET integrated database retrieval system