KEGG   Serratia proteamaculans: Spro_1987Help
Entry
Spro_1987         CDS       T00595                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spe  Serratia proteamaculans
Pathway
spe00900  Terpenoid backbone biosynthesis
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01130  Biosynthesis of antibiotics
Module
spe_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spro_1987
Enzymes [BR:spe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Spro_1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABV41090
UniProt: A8GDA0
Position
complement(2174847..2175713)
Genome map
AA seq 288 aa AA seqDB search
MIRQWPSPAKLNLFLYITGQREDGYHLLQTLFQFLDYGDTLTIDVRQDDAIHLLTPVAGV
PDEQNLIVRAARLLQQHCDRHGLNTAPRGAEISIEKRLPMGGGLGGGSSNAATVLVALND
LWRCGLSDEQLAELGLALGADVPVFVRGHAAFAEGIGERLQPANPQEKWYLVAHPGVSIP
TPVIFGDADLKRDTPVRPLNVLLQATYANDCEPIARKRFREVEQLVSWLLEYAPSRLTGT
GACVFAEFDTETAARQVLNQAPEWIRGFVARGVNVSPLHRIRSGQIEP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtcaatggccatcgcccgctaaactcaatttgtttttgtacattaccggccaa
cgtgaagacggctaccacctgctgcagacgctgttccagtttctggattacggcgacacg
ctgaccatcgacgtgcgccaggatgacgccattcacctgctgaccccggtggccggcgtg
ccggatgagcaaaacctgatcgtccgcgccgcccgtttgctgcaacagcattgcgatcgt
catgggctaaacaccgccccgcgcggtgccgagatcagcatcgaaaaacgtctgccgatg
ggtggcggactgggcggcggttcctccaacgccgccacggtgttagtggcgctcaatgat
ctgtggcgctgcggcttgagcgacgagcagttggcagagctggggctggcccttggtgcc
gatgttccggtgttcgttcgcggccatgccgcctttgccgagggcatcggtgaacgtttg
caacctgccaatccgcaggaaaagtggtatctggtggcccatccgggtgtcagcatcccg
accccggttatttttggcgatgccgatttaaaaagagacaccccggttcgcccattaaat
gtgctgttacaggcaacttacgcaaatgattgcgaaccaatagcaagaaaacgttttcgc
gaggttgaacagcttgtttcttggctgttagaatacgcgccgtcacgcctgactggcaca
ggtgcttgtgtgtttgctgaattcgacacagaaaccgccgcccgtcaggtgttaaatcaa
gccccggagtggatacgtggttttgtagcgcgtggcgttaacgtctctccactacatcgc
attcgttccgggcagattgaaccgtag

DBGET integrated database retrieval system