KEGG   Serratia proteamaculans: Spro_2403Help
Entry
Spro_2403         CDS       T00595                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
spe  Serratia proteamaculans
Pathway
spe00010  Glycolysis / Gluconeogenesis
spe00071  Fatty acid degradation
spe00350  Tyrosine metabolism
spe00625  Chloroalkane and chloroalkene degradation
spe00626  Naphthalene degradation
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01120  Microbial metabolism in diverse environments
spe01130  Biosynthesis of antibiotics
spe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spro_2403
  Lipid metabolism
   00071 Fatty acid degradation
    Spro_2403
  Amino acid metabolism
   00350 Tyrosine metabolism
    Spro_2403
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Spro_2403
   00626 Naphthalene degradation
    Spro_2403
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Spro_2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Peptidase_M73 Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABV41504
UniProt: A8GEG4
Position
2625325..2626338
Genome map
AA seq 337 aa AA seqDB search
MKAAVVTKNHSVDIQEKQLRPLKYGEAALKMECCGVCHTDLHVKNGDFGEVPGITLGHEG
VGVVTAVGEGVTSLKVGDRASVAWFYQGCGHCEYCVNGNETLCRSVKNAGFSVDGGMAEE
CIVVADYAVKVPDGLDSFAASSITCAGVTTYKAVKISDIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNQGQLDFAKEIGADLVINSKTENAEEIIQQKVGGAHAAVVTAVARS
AFNSAVNAVRAGGKVVAVGLPPESMDLSIPRLVLDGIQVVGSLVGTREDLKEAFQFAAEG
KVTPKVTKRPLGDINAIFEEMKSGTIRGRMVIDLSAS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgccgtagttactaaaaaccacagtgtagatattcaggaaaagcagcttcgc
ccactgaaatatggcgaagcggcactcaagatggagtgttgtggggtctgtcacaccgat
cttcacgtcaagaatggcgattttggcgaagtccccggcatcaccctgggccatgaaggg
gtcggggtggtcactgccgtcggcgagggcgtaacctcgttaaaagtcggggaccgtgcc
agcgtcgcctggttctatcagggctgtggccattgcgaatattgcgtcaacggtaacgaa
accctgtgccgttcggttaaaaatgccggtttcagcgtggacggcggcatggcggaagag
tgcatcgtggtggcggactatgcggtcaaggtgcccgacggcctggactcgtttgccgcc
agcagcatcacctgcgccggggtcaccacctataaggcggttaaaatttccgacatcaaa
ccggggcaatggatcgcgatttatggcctgggcggattgggcaatctggcgttgcagtat
gccaagaacgtgtttaatgccaaagtgatcgccattgacgttaatcaggggcagttggat
ttcgccaaagaaattggggcggatctggttatcaactctaaaactgaaaacgccgaagaa
attattcagcaaaaagtcggtggcgcacatgccgccgtggttaccgccgtggcgcgttcg
gcctttaactctgcggtgaatgccgtgcgtgccgggggtaaggtcgtggccgtgggcctg
ccgccagagagtatggacctgagcattccgcgtttggtactggacgggatccaggtagtg
gggtcgctggtcgggacccgggaagatctgaaagaagccttccagtttgccgccgaaggc
aaagtgacgccgaaagtcaccaaaaggccgctgggtgacatcaacgccatctttgaagag
atgaaatccggcaccattcgtggccgtatggttatcgatctttccgcctcttaa

DBGET integrated database retrieval system