KEGG   Serratia proteamaculans: Spro_2559Help
Entry
Spro_2559         CDS       T00595                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
spe  Serratia proteamaculans
Brite
KEGG Orthology (KO) [BR:spe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Spro_2559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TctB
Motif
Other DBs
NCBI-ProteinID: ABV41660
UniProt: A8GEX0
Position
2813756..2815366
Genome map
AA seq 536 aa AA seqDB search
MSDNSAVQAGAPTASSLPKIYQKNSRLTVLFFVFLLVLGIAFAGVNLFNDVSDAGAVYTS
YLPFLLLGLALLIALGFEFVNGFHDTANAVATVIYTHSLSPMVAVVWSGFFNFLGVLLSS
GVVAFGIISLLPVELILQAGTGNGFAMVYALLFSAIIWNLGTWWLGLPASSSHTLIGSII
GVGVANALIHGRTGTSGVDWGQAIKVGYALLLSPVIGFVFAALLLLALKVFVKNRQLYTA
PKNDSPPPLWIRGLLILTCTGVSFAHGSNDGQKGMGLIMLILVGTMPIAYALNRSMPPEQ
IPRVAALAEVTKNQLLHQFPQVSQTPPRDVLTGYVRTSELTAEVVPALAQLTGAIGDQIR
QYGSVDKIPAQAVSNTRNDMYLASEVIKHLKSEKQLQLSADSQRNLDALKSDLDNATRFI
PFWVKVVVAIALGLGTMVGWRRIVVTVGEKIGKSHLTYAQGASAELVAMTTIGAADIFGL
PVSTTHVLSSGIAGTMAANRSGLQMSTLRNLLMAWVLTLPASVLLSAGLYWIFTHF
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataacagcgccgttcaggcaggtgcgccaaccgcgtccagcctgccaaaaatc
taccaaaagaacagtcgactcactgttcttttttttgtttttttattagtgctggggata
gcttttgccggggtgaatttatttaacgacgttagcgatgccggtgcagtatataccagc
tacctgccgttccttttattggggttagcgttgctgattgcgctgggttttgaatttgtt
aatggttttcatgataccgccaatgcggtggccaccgttatttatacccattcattgtcg
cccatggtggccgtggtttggtcagggttctttaactttctcggcgtgttgctttccagc
ggagtggtggcgttcggcatcatttcgctgttgccggttgagttgatcttgcaggccggt
accggcaatggctttgccatggtttacgccctgctgttctcggcgattatctggaacctc
ggcacctggtggctcgggctgccggcctcctcgtctcataccctgattggctcgattatc
ggcgttggggtagccaatgcgctaatccatggccgcaccggcaccagcggtgttgactgg
ggccaggcgattaaggtgggctacgccttgttgctttccccggtgatcggttttgtgttt
gccgccctgctgctgctggcgctgaaagtcttcgtcaaaaatcgtcagttgtacaccgcc
cccaagaatgattcgccgccgccgctgtggatccgcggtttgctgatcctcacctgtacc
ggggtttcctttgcccatggctccaacgacgggcaaaaaggcatggggctgatcatgctg
atcctggtcgggaccatgccgattgcctacgcgctgaaccgctccatgccgcccgagcaa
atcccccgcgtggcggcactggcggaggtcaccaaaaaccaactgctgcaccagttcccg
caggtcagccagactccgccgcgcgacgtgctgaccggctatgtgcgtaccagtgaactg
accgcagaagtggtcccagcgctggcgcagttgaccggggccattggcgatcaaattcgt
cagtacggctcggtcgacaaaatccctgcgcaggcggtttccaacacccgtaacgatatg
tatctggcatcggaggtgattaaacaccttaagtcggaaaaacagctgcaattatccgct
gactcgcagcgcaatctggatgccctgaaaagcgatctggacaacgccacccgctttatc
ccgttctgggtcaaggtggtggtagctattgctctggggttgggcaccatggtcggctgg
cggcgcattgtggtcaccgttggtgagaaaatcggcaaaagtcatctgacctatgcccag
ggggccagtgccgaactggtggcgatgaccactatcggcgcggcggacatttttggttta
ccggtctccaccacccacgttctgtcatccggcatcgccggtaccatggcggccaaccgc
tccggcctgcaaatgtccaccctgcgcaatctgctgatggcctgggtgttgacgctgccg
gcctcggtgctgctttctgccgggctgtactggattttcacccatttctaa

DBGET integrated database retrieval system