KEGG   Serratia proteamaculans: Spro_2998Help
Entry
Spro_2998         CDS       T00595                                 

Definition
(GenBank) protein of unknown function DUF876
  KO
K11893  type VI secretion system protein ImpJ
Organism
spe  Serratia proteamaculans
Brite
KEGG Orthology (KO) [BR:spe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:spe02044]
    Spro_2998
Secretion system [BR:spe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Spro_2998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ABV42099
UniProt: A8GG59
Position
3295120..3296466
Genome map
AA seq 448 aa AA seqDB search
MKDAHKVVWTEGMFLRPHHFQQAENYLENYMRNWGQAHQGYFWGFLQLDLDQTLLRQGKI
ALNAASGIMPDGTPFRFSGAQQAPAPLAIAENKTGENVVLALPTYRAGREDVIFQEAPDA
LARYLAYENEVDDLNAVSVGSAALQFGQLRLRLMLESELNAEWTALGVTRVLEKRGDASL
RLDQVQIPPMLNCQGSPVLKTFINDLQGLLQQRSQQMSQRLLQPGRGGSSEMVDFMLLQL
INRHLGQVSHAYHLDHLHPERLFADWLQFATELASFSAQRTPEARLPVYDHDNLALCFGK
LMLLLRQGLSVVLEDNAIQLTLVERSHGLNIATVQDTKMMRDFGFVLAVRADVAAEVLLT
HFPAQMKIAPVTRIRDLVQLQLPGIGLRTMPAAPRQIPYHAGYTYFELEKGSDLWKQMEK
SSAFALHLAGDFPGLDMEFWAIRSHTDR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgctcataaggtcgtctggactgaagggatgtttttgcgccctcatcatttc
cagcaggcggaaaactatctcgaaaactacatgcgtaattggggccaggcccaccaaggt
tatttttggggcttcctccagctggatttggatcaaaccttgctgcgtcagggcaaaatt
gcgcttaacgccgctagtggcatcatgccggacggcacgccctttcgtttttccggtgcc
caacaggcgcctgctccgctggccattgccgaaaacaagaccggcgaaaacgtggttctg
gcattgccaacctaccgcgcgggccgtgaagacgtgatttttcaggaagcaccggacgcg
ctggcgcgttatctggcctatgaaaacgaagtcgacgacctgaacgccgtttcggtcggc
agcgcggcattgcagtttggtcagctgcgtctacgtctgatgctggaaagcgaactcaat
gccgaatggacggccctcggcgtaacccgggtgctggaaaaacgcggtgacgccagcctg
cgtctcgatcaggtgcaaattccgccgatgctgaactgtcagggaagcccggtgctgaaa
acctttatcaacgatctgcaaggcctgctgcaacagcgtagccagcagatgagtcagcgc
ctgctgcagccggggcgcggcggcagttccgagatggtcgatttcatgctgttgcaactg
attaaccgccatctcggccaggtgagccacgcttaccatctcgatcacctgcacccggaa
cgcctgttcgccgactggctgcagttcgccaccgagctagccagcttctcggcgcagcgc
acaccggaagcccggctgccggtgtacgaccatgacaacctggcgctgtgtttcggcaaa
ttgatgctgttgctgcgccaggggctgtcggtggtactggaagacaacgccatccaactg
acgctggtcgaacgctcgcatggcctgaacattgccaccgtacaagacaccaaaatgatg
cgcgacttcggtttcgtgctggcggtacgtgccgatgtcgccgccgaagtgctgctgact
cacttcccggcgcaaatgaagattgccccggtaacgcgtattcgcgatctggtgcagttg
caactgccaggcatcgggctgcgcaccatgccggcggcaccacgccaaatcccctatcac
gcgggttatacctatttcgaattggaaaaaggcagtgacctgtggaagcagatggaaaaa
tccagcgccttcgctctgcacctggccggcgacttcccgggtctggatatggaattctgg
gcgattcgcagccatacggaccggtaa

DBGET integrated database retrieval system