KEGG   Serratia proteamaculans: Spro_3003
Entry
Spro_3003         CDS       T00595                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
spe  Serratia proteamaculans
Brite
KEGG Orthology (KO) [BR:spe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:spe02044]
    Spro_3003
Secretion system [BR:spe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Spro_3003
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABV42104
UniProt: A8GG64
Position
3303219..3303755
AA seq 178 aa
MPNSKSRSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKSVDPQASVD
ERKFLEIDIDNFDERMKSLKPRVAYQVDNTLTGEGKLNIDLTFESMEDFSPAAIARKVDA
LDNLLDARTQLSNLLSYMDGKNGAEELISKILQNPALLQSLTDAPKPAATDDNNQRED
NT seq 537 nt   +upstreamnt  +downstreamnt
atgccaaactcgaaatcccgtagcgggcagaaatttatcgcccgcaaccgcgcaccgcgc
gtacagattgaatacgatgtcgaaatttatggcgcagagcgcaaaatccagttgccgttc
gtgatgggcgtgatggcagacctggtggggaaatcggttgatccacaggcgagcgttgat
gagcgcaagttcctggagatcgacatcgacaacttcgatgaacgcatgaaatcgctgaaa
ccgcgcgttgcctatcaggtcgacaacaccctgaccggcgaaggcaaactgaatatcgat
ctgacgtttgaaagcatggaagacttctcccctgcggcgattgcccgcaaggtggacgcg
ctggacaacctgctggacgcccgcacccagctttccaacctgttgtcttatatggatggt
aaaaacggcgctgaagaactgatctccaaaatcctgcaaaacccggccttactgcaatcc
ctgaccgatgcgccgaaaccggccgccacggacgacaacaatcagcgtgaggactaa

DBGET integrated database retrieval system