KEGG   Serratia proteamaculans: Spro_3010Help
Entry
Spro_3010         CDS       T00595                                 

Definition
(GenBank) GPW/gp25 family protein
  KO
K11897  type VI secretion system protein ImpF
Organism
spe  Serratia proteamaculans
Brite
KEGG Orthology (KO) [BR:spe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:spe02044]
    Spro_3010
Secretion system [BR:spe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Spro_3010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25 DUF5600 DUF2113
Motif
Other DBs
NCBI-ProteinID: ABV42111
UniProt: A8GG71
Position
3310595..3311170
Genome map
AA seq 191 aa AA seqDB search
MNSKRPTQHDDGDLRRQGYRSRQDSERLTSRDKMQPVLLDMLTDDEPQKKKEAQVRNLVS
HSELRRRVLRDLQWLFNCVNSEASLDLGDFPQVRRSTLNYGIASLAGKRMSDIEWQDIQL
ALTESILNFEPRILPEGLQVRCISDTGSLELHNVLSIEIKGRLWCVPYPLEFLFRTDVDL
ENGHFDLKDIG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaagcggccaacccaacatgatgatggtgacctgcgccgtcagggctatcgc
tcccgccaggacagcgaacgcctgacctcgcgcgacaaaatgcagccggtgctgctcgac
atgctgaccgacgacgaaccgcagaaaaaaaaggaagctcaggtgcgcaacctggtctcg
cacagcgaactgcgccgtcgggtgctgcgcgacctgcagtggctgtttaactgcgtgaac
agcgaagccagtctcgatttgggcgattttccgcaggtacggcgttcaaccctgaactac
ggcatcgcctcgctggccggcaaacgcatgtcagacatcgaatggcaggatatccagttg
gcgctgaccgaatccatcctcaatttcgaaccgcgcatcctgcccgaagggctgcaggtg
cgctgcatttcagataccggctcgctggagctgcacaacgtattgtcgattgaaatcaag
gggcgcctgtggtgtgtgccctatccgctggagtttctgttccgtaccgacgtggacctg
gagaacggccacttcgatctgaaagacatagggtaa

DBGET integrated database retrieval system