KEGG   Serratia proteamaculans: Spro_3012
Entry
Spro_3012         CDS       T00595                                 

Definition
(GenBank) protein of unknown function DUF1305
  KO
K11895  type VI secretion system protein ImpH
Organism
spe  Serratia proteamaculans
Brite
KEGG Orthology (KO) [BR:spe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:spe02044]
    Spro_3012
Secretion system [BR:spe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Spro_3012
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ABV42113
UniProt: A8GG73
Position
3313058..3314131
AA seq 357 aa
MSTLDAEAELTAPPQINALHRLPEDFWLRLGNAPYKHDLFQLLRRLDAQGGQPYLLGRAP
LPRHEMLRLGQEPSLSFAPSTLAQVSPRPQSSLHDVSIFSFGLFGPNGPLPLHLTEYVRE
RVYHHQDTTLLAFANLFHHRLTLLFYRAWADAQPTVSLDRQDNRRFDQYLSSLIGIGQPA
QQQRDSINAHAKHFMAGHLIRHSRDPEGLSKILQQYFKVPVRIVENVPHWLRVEPREQAR
LKAGRGAPRLGESSFLGIAVRDIQHKFRIELGPMSQQNYEGFLPGAELCRQLRDWVRQYL
GIEFVWELRLILAKDQLSGTQLGGAQRLGLSSWLEDARQQRDLDDLIFSPEPLENPF
NT seq 1074 nt   +upstreamnt  +downstreamnt
ttgagcactcttgacgccgaggcggaactgacggcaccgccacagatcaatgccttgcac
cgcctgccggaggatttctggctgcggctcggcaatgcgccttataaacacgatttgttt
cagctgctgcggcgcctcgacgcccagggcggccagccatacctgctgggccgtgccccc
ctgccgcgccatgagatgctgcggctggggcaagaaccttcactgtcgttcgctccgtcg
acgctggcacaggtcagcccacggccgcaaagctcgctgcacgacgtttctattttcagc
tttggcctgtttggccccaacgggccgctgccgctgcacctgaccgaatacgtgcgtgaa
cgggtctatcaccaccaggacaccaccctgctggcctttgccaacctgtttcaccaccgg
ctgacgctgctgttttaccgcgcctgggccgacgcacagcccacggtatcgctggatcgt
caggataaccggcgtttcgaccaatacctttccagcctgattggcatcggccagccggca
cagcagcagcgcgacagcatcaatgcccatgccaagcattttatggccggtcatctgatt
cgccacagccgcgatccggaaggcctgagcaaaatcttgcagcagtatttcaaggtgccg
gtgcgcatcgtggaaaacgtcccgcactggctgcgggtagaaccgcgcgaacaggcgcgc
ctgaaggccggtcgcggcgccccccggctcggtgagtcttcgttcctcgggattgccgtg
cgcgatattcagcacaaattccgcatcgaactggggccgatgtcgcaacaaaactatgaa
ggcttcttgcccggagccgaactgtgccggcagttgcgcgactgggtgcgccagtatctg
ggcattgagtttgtttgggaactgcggctgatcctggccaaggatcagctcagcggcacc
caactcggcggtgcccagcgcctgggattaagcagttggctggaagacgcccgtcagcaa
cgcgaccttgacgatctgatcttcagccccgaaccgctggaaaacccgttctga

DBGET integrated database retrieval system