KEGG   Serratia proteamaculans: Spro_3019Help
Entry
Spro_3019         CDS       T00595                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
spe  Serratia proteamaculans
Pathway
spe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:spe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Spro_3019
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:spe02044]
    Spro_3019
Secretion system [BR:spe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Spro_3019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ABV42120
UniProt: A8GG80
Position
3324102..3324584
Genome map
AA seq 160 aa AA seqDB search
MAIDSFLKVDGVTGESNDSNHKNWTDILSFNWGATQSGNMAVGGGGGTGKVNFKDLEVQA
LIDKSTPAILKFCSSGKHVTKVELSICKAGGTQVEYTRIVLEDVLVSMADFTGVGHTDNI
LVKYRFQASKVNLHYWEQSASGTKGAETKAGWDIKQNKEI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgactcatttctgaaggttgacggggttactggcgaatctaatgattcgaat
cacaaaaattggactgatattctgtcattcaactggggggcgacccagtctggcaatatg
gccgtaggcggtggcggcgggacggggaaagtaaacttcaaggatttggaggtgcaggca
cttatcgataaatctacaccggccattctgaagttttgctccagcggtaaacatgtaacc
aaagtagaactttctatctgcaaggccgggggcacccaggtcgaatataccaggatcgtg
ctggaagatgtcctggtcagtatggcggactttaccggtgttgggcacaccgacaatatc
ctggttaaatatcgttttcaggcttccaaggtcaatctgcattactgggagcaaagcgcc
agcggcaccaagggtgcagaaaccaaagccggttgggatattaaacagaataaagagatt
taa

DBGET integrated database retrieval system