KEGG   Serratia proteamaculans: Spro_3026Help
Entry
Spro_3026         CDS       T00595                                 

Definition
(GenBank) Semialdehyde dehydrogenase NAD - binding
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
spe  Serratia proteamaculans
Pathway
spe00360  Phenylalanine metabolism
spe00362  Benzoate degradation
spe00620  Pyruvate metabolism
spe00621  Dioxin degradation
spe00622  Xylene degradation
spe00650  Butanoate metabolism
spe01100  Metabolic pathways
spe01120  Microbial metabolism in diverse environments
spe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spro_3026
   00650 Butanoate metabolism
    Spro_3026
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Spro_3026
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Spro_3026
   00622 Xylene degradation
    Spro_3026
   00621 Dioxin degradation
    Spro_3026
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Spro_3026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh Shikimate_DH Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ABV42127
UniProt: A8GG87
Position
complement(3329591..3330478)
Genome map
AA seq 295 aa AA seqDB search
MTLSVAVIGTGAIGMDLVNKIYRSSWLHCGLVAGRNKDSAGLAIATELGCPISAGGIDAI
LAAPKPFDVVFDATNAMSHVKHWELLRPLGTLLIDLTPSHLGKMIVPTVTGTEALTDRNV
SLISCGGQASIPILHALSRHFQINDIEVVATVASNILGRATRVNIDEYVETTQIALSAFT
GVANTKAILNISPATPPAMFRVTIFADIPGVTAEQITPVVTAAAAAVREFSAGYRLTALK
VTEGRASISLEVTASSKVMPEYAGNLDLINSAAILVAEQYAHYRNKAEVANDYSH
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgctctccgttgccgtgatagggaccggcgccatagggatggatctggtcaataaa
atatatcgctcatcctggctgcattgtgggctggtggcagggcgcaacaaggactcggcc
ggtttggcgattgccactgagctgggttgcccgatcagtgccggcggtatcgacgccatt
ctggctgcccccaagccattcgatgtggtgttcgacgccaccaacgccatgtcacatgtc
aaacactgggagttgctacgcccgctgggtacgttgctgatcgacctgactcccagccac
ctggggaaaatgatcgtccccacggtgaccggtaccgaagccctgaccgatcgcaatgtc
agtttgatcagttgcggtgggcaggcgtcgatcccgatcctgcatgccctgagccggcat
ttccaaattaacgacatcgaggtggtggcgaccgtagccagcaatattttggggcgagcg
accagagtcaacatcgatgaatacgtagaaaccacgcagattgcgctcagcgctttcacc
ggcgtggcaaataccaaggcgatcctcaatatcagcccggccactccgccggccatgttc
agggtcactatatttgccgatattcccggcgtgacggcagaacagataaccccggtggtc
acagcggcggcggcggcggtgcgggagttttcggcgggttatcggttaacggcgctcaag
gtgaccgaagggcgagcgtcaatctcgctggaggtgacggccagcagcaaggtgatgcct
gaatacgcgggcaacctggacctgattaattccgctgccattctggttgccgaacagtat
gcgcactatcgaaataaagcggaggtggccaatgactattctcattaa

DBGET integrated database retrieval system