KEGG   Serratia proteamaculans: Spro_3583
Entry
Spro_3583         CDS       T00595                                 
Name
(GenBank) major facilitator superfamily MFS_1
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: MFS_1 Sugar_tr OATP
Other DBs
NCBI-ProteinID: ABV42679
UniProt: A8GHT9
Position
complement(3958225..3959460)
AA seq 411 aa
MSDKTLDPICAAQDGALSRLPASLVLLLAGASAFSVANVYYAQPLLDAIAQDFHISLASV
GMVITVTQLGCALALLLVVPLGDRVNRHRLLAVQQLLLITALCVVGWANSSLLLLVGMLL
VGLLGTAMTQGLVAFAATLAAPHERGRVVGAAQGGVVLGLLLARTLSGAMADIGGWRAVY
FFSAAVTLLLLPVLARLLPVPDIAPSTLSYPALLRSMLTLLWRDRTLQIRGMLALLMFAA
FSIFWSALVLPLSQAPFNFSHSVIGAFGLVGSVGALAAVRAGHLADRGLGQLATGICLLL
LVLAWLPLGLLSYGLGWLIMGIVLLDLAGQAIHVLNQSLIFSAHPQAHSRLVGCYMLFYA
VGSGLGAFASTHVFALAGWYGVCWLGASVSLAALLFWGLTLRAMPASNAAH
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgagtgataaaacgctggatccgatttgtgccgcgcaggacggagcgctgagtcgcctg
cctgcgtcgctggtgttattgctggcgggagccagtgcctttagcgtggcgaatgtgtat
tacgcacaacctttactggacgccattgctcaggattttcatatcagcctggcgtcggtg
ggcatggtgatcaccgtcactcagttaggctgcgcattggcattgttgctggtggtgccg
ttgggcgatcgggttaatcgtcaccggctgctggcggttcagcaactgctgctgattacc
gcactttgtgtggtcggttgggcgaacagcagcctgttattactggtcggcatgctgctg
gtggggttactgggtaccgccatgacccagggattggtcgccttcgccgctacattggca
gcgccgcatgagcggggacgggtagtgggcgccgcgcaaggcggtgtggttctcgggttg
ttattggcgcgcacgctttccggcgcaatggcggatatcggtggctggcgcgcggtttac
tttttctctgcggcggtaaccctgctcctgttgccggtgcttgcgcgtctgttgcccgtc
ccggacatagcgccttcaacactcagttatccggcgctgttgcgatcaatgctgacgttg
ctgtggcgcgatcgcacgctacagatccgcggcatgctggcgctgctgatgtttgcggca
ttcagcattttctggagtgccctggttctgccactcagtcaggcgccgtttaatttttca
cattcggtgattggtgcctttggtctggtggggtcggtgggagcgctggcggcggttcgt
gccggacatttggccgatcgcggtctggggcagttggcaacaggtatctgtctgttgctg
ttggtgctggcctggttgccgctcggcctgctgagttacgggctgggatggttgattatg
ggcattgtgctgctcgatctggccggacaggccattcacgtgttgaatcagagtctgatt
ttcagcgcccatccgcaggctcatagccggttagtcggctgctacatgctgttctacgcg
gtgggtagcgggctgggtgcctttgccagtacccacgtattcgctctggcgggctggtac
ggcgtgtgttggctgggggcgagcgtcagcctggcggccttgttgttctgggggctgacg
ctgcgtgccatgccagcctcaaatgcggcgcattag

DBGET integrated database retrieval system