KEGG   Serratia proteamaculans: Spro_3796Help
Entry
Spro_3796         CDS       T00595                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
spe  Serratia proteamaculans
Brite
KEGG Orthology (KO) [BR:spe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spe03016]
    Spro_3796
Enzymes [BR:spe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Spro_3796
Transfer RNA biogenesis [BR:spe03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Spro_3796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABV42892
UniProt: A8GIF2
Position
complement(4196562..4197332)
Genome map
AA seq 256 aa AA seqDB search
MLEILYQDEHLVAVNKPSGWLVHRSWLDRHETRFVMQTVRDQIGQHVFTVHRLDRPTSGV
LLMALSSEVARLLSQQFEQHQMQKTYHAVVRGYVLEGATIDYPLTEELDKIADKFASKDK
GPQPAVTHYRPLARVEMPVAIGRYESARYSLVELKPENGRKHQLRRHMVHIRHPIIGDSK
HGDLNQNRGMAQHFGCPRLMLHASHLQLNHPVTGEPLHLSARWDEPWQGVMSQFGWTENL
PELARVEFPPASGQDN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagattctatatcaggatgagcatttggtggcggtgaacaagccttccgggtgg
ttggtacaccgcagctggctggatcgccatgaaacccggtttgtgatgcaaaccgtgcgc
gatcagattggccagcatgtgtttaccgtgcatcgcctcgatcggcccacctcaggggtg
ctgctgatggcgctgtccagtgaggtggcacggttgctgtcgcagcagtttgaacagcat
cagatgcagaaaacctatcacgcggtggtgcgtggttacgtgctggagggggcgaccatc
gactatccgctgacggaagagctggacaaaatcgccgacaagtttgcctctaaagacaaa
ggcccgcagccggcggtcactcattaccggccgctggcgcgggtagaaatgccggtggcg
attggccgttacgaaagcgcgcgctacagcctggttgaactgaagccggaaaatggccgc
aagcaccagttgcgccgccatatggtgcatatccgccatccgattattggtgacagcaaa
cacggcgacctgaaccagaaccggggtatggcccagcattttggctgtccacgcctgatg
ctgcatgccagtcatctgcaactgaatcatccggtgaccggtgagccgctgcatctttcc
gcgcgctgggatgaaccctggcagggagtcatgtcacagtttggctggacagagaatctc
cctgagcttgccagggttgagtttcccccggctagcggtcaggataactga

DBGET integrated database retrieval system