KEGG   Serratia proteamaculans: Spro_4073
Entry
Spro_4073         CDS       T00595                                 

Definition
(GenBank) conserved hypothetical protein
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: ParB DivIC KfrA_N
Other DBs
NCBI-ProteinID: ABV43168
UniProt: A8GJ78
Position
complement(4515629..4517110)
AA seq 493 aa
MNNTMNKSLWGRRSLLSLLIAGSLTLAGVNAHADDNDDNGTLFGVSLPQVNDSNVGYGKS
ASGAVSDKLFYSLGGGSVISQPATRGNMQRLGMNLGWSSDLMCGNFDLKTTIGNQLNGVT
DGFKNLMGSVIQGATGAVASLPAMAIQRANPGLYEMLTNGVLQGGVAFDKAQLNCQNLSK
RMMDMADSGGWSQAAAMEEAKSLINNGDADAVRSMNATEKVTGQSGQTWIGGQKRGGAGQ
PAIKPTHDLAAAGYNMMNALPVTSTSSVSGSSCTGGACAKYASSEEAAAAVVKVLGDSSL
RTCKDAAQCTSGEGSEQPGSTVAGTGFAPMLEEATKENNQQLAKLVNGAEKPTAANLAKL
KTGSLAVTAGVIKALQRDPDNAALVGRLASELAMADTIETAFIMRRMVTTGMSEPNAAVQ
KMAMEEGDRRIEALDREITALKNEMEMKREIARNAVLTIIDRENNRAETNPQRQSVDSPD
TKFNQLAVPESDQ
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaataacacgatgaataaatctctctggggacggcgcagcctgctgtctctgctgatt
gccggcagcctgacgctggccggcgtgaacgcacacgctgacgacaatgatgataacggc
accctgtttggtgtttcgttgccgcaagtcaatgacagcaacgtagggtacgggaagagc
gccagcggcgcagtctcggacaagctgttttactccctgggcggcgggtcggtgatttca
cagccggcgacgcgtggcaacatgcagcggctgggtatgaacctgggctggagctcggat
ttgatgtgcggcaatttcgacttgaagaccaccattggcaaccagctcaacggggtgacg
gacggcttcaagaacctgatgggcagtgttatccagggggctaccggtgcggtggccagc
ctgccggcgatggctatccagcgagccaacccgggattgtatgaaatgctgaccaacggg
gtactgcagggcggcgtcgccttcgacaaggcacagttgaactgtcagaacctctccaaa
cggatgatggatatggcagactccggtggctggagccaggccgctgcgatggaggaagcg
aaaagcctgatcaataacggggatgctgatgcggtgcggtcgatgaatgccacggagaag
gtaaccgggcaatccggccagacctggatcggcggtcagaagcggggcggcgccggccag
cctgccatcaagccgacgcacgacctggcggcagccggctacaacatgatgaatgcgctg
ccggtcaccagtacctcgagcgtatccggcagcagttgcaccggcggtgcctgtgccaaa
tatgccagtagtgaagaagcggccgctgccgtggtgaaggtgttgggggattcttctctg
cgtacctgtaaagatgcggcgcaatgtaccagtggggaaggcagcgaacagcccggcagt
accgtggccggcacgggttttgccccgatgctggaagaagcgacgaaggaaaataaccag
cagttggccaaactggtcaacggggcagagaaacccaccgcggccaacctggccaaactc
aaaacgggcagcctggcggtgacagccggcgtcatcaaggcactgcagcgcgacccggat
aatgctgcactggtcggccgcctggctagcgaactggcgatggcggacaccattgaaacg
gcctttatcatgcgccgtatggtcaccaccggcatgtcagagcctaatgctgctgtccag
aaaatggcgatggaagagggcgatcgacgtatcgaggcgctggaccgtgaaatcacggcg
ctgaagaacgagatggaaatgaagcgcgagattgcgcgtaacgcagtgctgaccatcatc
gatcgtgagaataaccgtgcggaaaccaacccgcagcgtcagtcggttgacagcccggac
accaagttcaaccagttggccgtaccggaaagcgaccagtaa

DBGET integrated database retrieval system