KEGG   Serratia proteamaculans: Spro_4075
Entry
Spro_4075         CDS       T00595                                 

Definition
(GenBank) protein of unknown function DUF1525
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: DUF1525 FbpC_C_terminal Thioredoxin_2
Other DBs
NCBI-ProteinID: ABV43170
UniProt: A8GJ80
Position
complement(4518130..4518534)
AA seq 134 aa
MKISTLLMLFPLLMPASVLAGTVLYTDSHHPPTNNDASVAVIYLDGPEQLQTQLFGALSS
NPDEAQRYAQAVLQSPKWQAHEQELATVYRAVVRAWELGVTKVPAVVFDNRDVVYGTADV
AQALALRAQSSGGQ
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaaaatcagtacgttgctgatgttgtttcctctgctgatgccggcatcggtgcttgcc
ggcacggtactctataccgattcccaccaccccccgacgaataatgatgcgtccgtggcc
gtgatttatcttgacggcccggagcagttgcagacgcagctatttggtgcattgtcgtcg
aacccggacgaagcgcagcgctatgcgcaagccgtactgcagtcaccaaagtggcaagct
catgaacaggagctggccacagtgtaccgtgcagtggtgcgtgcctgggaactgggcgtg
acaaaagtaccggccgtcgtgtttgacaacagggatgtggtgtatggcacggctgacgta
gcccaggctttggcactgcgcgcccagtcatcgggggggcagtga

DBGET integrated database retrieval system