KEGG   Serratia proteamaculans: Spro_4089
Entry
Spro_4089         CDS       T00595                                 

Definition
(GenBank) conserved hypothetical protein
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: DUF3438 DUF515
Other DBs
NCBI-ProteinID: ABV43184
UniProt: A8GJ94
Position
complement(4548173..4549090)
AA seq 305 aa
MMKARVLALSLSVLPLAAMFTVPVAQAEELMKWERIPLQIPLAVGKERVLFADKNVRVGF
PPALNGKLRVQSSGGAVYLKADSAFPPTRLQLQDVENGEVILLDVAASDKGSAEPVRIVY
SGDVSSVSSSNDTSSSSVGNSSGSAAPGADDGTQAKRKKIKYNAPLPVVLTRYAAQSLYG
PVRTVEAVPGIHPVNPHLPKRITTLYPSEPVAITPLGGWGIGSRNVVALKVQNTASRKIT
LDPRVLQGQFVTATFQHRYLGPVGTPEDTTTLYLVTAGRPDGAFVAEPSVVRKAVKAAKK
GANHG
NT seq 918 nt   +upstreamnt  +downstreamnt
atgatgaaagcacgcgtactggcgctttccctgagtgtgcttcccctggcggcaatgttc
accgtgccggttgcccaggcggaagagctgatgaaatgggagcgtatcccgttgcaaatt
ccgctggccgtcggtaaggagcgggtgttgtttgccgacaaaaatgtccgcgtcggtttc
ccgccggcgctgaacggcaagctgcgggtgcaaagcagcggtggtgcggtttacctgaag
gcggacagcgcgtttccgccaacgcgactgcagctgcaggacgtagaaaacggggaggtt
attctcctcgatgtggctgcatcggacaaaggctccgccgagccggtgcgcattgtctac
agcggtgatgtgtcgtcggtcagcagcagtaatgatacctcgtcctcgtcagtcggcaac
agttcgggttcggcagcgcctggggcggatgatggcacccaggcgaagcgtaaaaaaatc
aagtacaacgccccgctgccggtggtactgacacgttacgcggcacaaagcctgtacggc
ccggtgcgtacggttgaagcggtgcccggcattcatccggttaacccgcacctgccgaaa
cgcatcaccacactgtacccgtcagagccggtggccatcacgccgctgggcggctggggc
attggcagtcgcaacgtggtggcgctaaaagtgcagaacaccgccagccgtaaaatcaca
ctggacccgcgggtgctacaggggcaatttgtgacggcgaccttccagcaccgctatctc
ggtccggtgggcaccccggaggacaccaccacgctgtacctggtcactgccggtcgcccg
gacggggcgtttgttgcggagccgtcagtggttcgcaaagccgtaaaggcggcgaagaag
ggggcaaaccatggctga

DBGET integrated database retrieval system