KEGG   Serratia proteamaculans: Spro_4096
Entry
Spro_4096         CDS       T00595                                 

Definition
(GenBank) putative plasmid transfer protein
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind T4SS-DNA_transf DUF87
Other DBs
NCBI-ProteinID: ABV43191
UniProt: A8GJA1
Position
complement(4552098..4554290)
AA seq 730 aa
MEVSMREGSAACTSNMTSLRMIRKVAMSNRHVMEALLRPAVELNTAIVAGGAAVVCAIAP
WSVALAPEVSYVTAGSFAVLSAVRARQGMRVIRYRGNLRRLPRYVMESRQIPVSRQRLFL
GRGFRWQQKHTQRLMDTRRPEVEKYVQPPKMYQMARHLELKTEYTLPWLSQLLRKDSPLN
PVRPLPPVGGNPAIHGIEPDELDVSMALGERVGHSLVLGTTRVGKTRLAELLITQDIRRG
DITIVFDPKGDADLLRRVWAEAHRAGRGDELFIFHLGWPDISARYNAVGRFERVSEVAGR
ISGQLSGEGNSAAFREFAWRFVNIVARALVALGQRPDYTLITRYVNNISELYETYAKKVI
ETRMPALQQQIDNNLQVLTEEDVPRNMQGQPNAVKIFAVEMALSSEAGKQLYDPILDGLR
SAVRYDRTYFDKIVASLLPLLEKLTTGKTAELLAPNYMDMSDPRPIFDWEQVIRKRGIVY
VGLDALSDGVVASAVGNSMFADLVSVAGHIYKHGMHGGLPTRADGKLPINLHCDEFNELM
GDEFIPLINKGGGAGMQVTAYTQTESDIEARIGSTAKAAQVTGNFNTLIMLRVRENRTAQ
LLTTQLPEVDIYTKTLVSGHADTADVEKGQDFTSNTQDRVGTVKAPLLAPADVINLPKGQ
AFALLEGGQLWKIRMPLPSGDRDDALMPANLQKIAEEMQRNYRTSESWWSASTVMPDVAI
QGGLNVASGE
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggaagtatcaatgcgcgaggggagcgcagcatgcacttccaatatgacaagcctgcga
atgataaggaaggtcgcaatgagtaaccggcatgtaatggaagccttgttgcgcccggcc
gtggaactcaacacggcgattgtggccggaggcgcggctgtggtttgtgcgatagcgccc
tggtcggtagcgctggcgccagaggtgagctatgtcaccgccggcagctttgcagtgttg
tctgccgtacgtgcgcgccaggggatgcgagtgatccgctaccgcggtaacctgcgccgg
ttaccgcggtatgtcatggaaagccgacagatcccggtgagccggcagcgactgttcctg
gggcggggttttcgctggcagcagaagcacacccagcgcctgatggacacccgtcgtcca
gaggttgagaagtatgttcagccgccaaaaatgtaccagatggcgcggcacctggagcta
aaaaccgaatataccctgccatggttgtcccaactgctgcgtaaggactccccgctcaat
ccggtcaggccgctgccaccggtcggggggaacccggcgatccacggtattgaacccgat
gagctcgatgtctcgatggcgcttggcgaacgcgtagggcatagcctggtgctggggacc
acccgtgtgggcaaaacgcgtctcgccgagttactgatcacccaggatattcgccgcggt
gatatcaccatcgtgtttgatccaaaaggtgatgcagacttgctgcggcgggtctgggct
gaagctcaccgtgctggccgcggggatgagctgttcatcttccacctaggctggccagat
atctcggcacgctataacgccgtggggcgttttgagcgggtgtcagaggtggctggtcgt
atctctggtcagttaagcggggagggcaacagtgcggcgttccgtgagtttgcctggcga
ttcgtcaacatcgtcgcgcgtgccctggttgcgttggggcagcgcccggactacaccctg
atcacccgatatgtgaacaacatcagtgaactgtatgagacctatgcgaagaaggtgatt
gaaacgcgtatgccggcactgcagcagcaaatcgacaataacctgcaggtgctgacggaa
gaggatgtgccgcgcaatatgcagggacaaccgaacgcggtcaaaatatttgcagtcgaa
atggccctgagctcggaggccggcaagcagctgtacgaccctattctggatggcctgcgc
tcggccgtgcgttatgaccgtacctacttcgataaaatcgtcgcctccctgttgccgcta
ctggagaaactcaccactggcaagactgcggagctgttggcgccgaactacatggatatg
agcgatccaaggcccatttttgactgggagcaggtcatccgcaagcgcggtattgtctac
gtggggttggatgccttgtcggacggggtggtcgcctctgccgtcggcaacagcatgttt
gccgacctggtatcggtggccggccatatctataaacacggcatgcacggcgggttgccg
acccgggcagacggtaaactgcctatcaacctgcactgtgacgagttcaatgagttgatg
ggggacgaatttatccctcttatcaacaaaggcggtggcgccggtatgcaagtgacggcc
tacacgcaaaccgagtcggatatcgaggcgcgcatcggcagtaccgccaaggcggctcag
gtcacggggaacttcaataccctgatcatgctccgcgtgcgtgagaaccggaccgcgcag
ttactcaccacacagttgccggaagtggatatctacaccaaaaccttggtatcagggcat
gccgatacggccgatgtggagaagggacaggattttacttccaatacccaagaccgcgtc
ggtaccgtaaaagccccactgcttgccccggcggatgtgattaacctgccgaaaggacag
gcgttcgcgctactggaaggcggtcaactgtggaaaattcggatgccactgcccagtggt
gacagggatgatgcgcttatgccggccaacctgcagaagattgccgaggagatgcagcgc
aactaccgtaccagcgagtcctggtggtcagccagcacggtaatgccggatgttgccatc
caaggggggctgaatgtcgcaagcggtgaataa

DBGET integrated database retrieval system