KEGG   Serratia proteamaculans: Spro_4098
Entry
Spro_4098         CDS       T00595                                 

Definition
(GenBank) conserved hypothetical protein
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: DUF2859 DUF4780
Other DBs
NCBI-ProteinID: ABV43193
UniProt: A8GJA3
Position
complement(4555342..4555866)
AA seq 174 aa
MKKVNFLLFGLSLVTTTALANLNVIADVGGEDASPYFEGINRQGDVVAPPVMTQAPTSAD
EVEGAVLPVTTPELTPGPVEERPLQLPGIGALFIVGDDDESRLWLQANAEQLKSRHAAGL
VVNVSNLPALQALRELAPGVPMAPASGSELARRLQLSNYPVLITDTGLSQQVGP
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaaaaaagtgaattttctgctgttcggcctgagtctggtgaccaccacggcgctggcc
aacctgaacgtgatcgcggatgtcggtggtgaggatgcttcgccgtattttgaggggatc
aatcggcagggcgatgtggtggctccgccggtcatgacgcaagcccccacatctgccgat
gaggttgaaggagcggtcttgccggtgacgacaccggaactgacaccgggtccggtagag
gagcgtccgttgcaactgcccgggattggcgcgctgtttattgtgggggatgacgatgag
agccggctctggctgcaggcgaacgcggaacaactcaaatcccggcacgctgcgggtctg
gttgttaacgtcagcaacctgcccgcactgcaggcgctgcgtgagctggcgccgggtgtg
ccgatggcgccagcctccggcagtgagttggcgcgccggctgcagctgtcgaattacccg
gtactcatcaccgataccggtctgtctcagcaggtcggaccatga

DBGET integrated database retrieval system