KEGG   Serratia proteamaculans: Spro_4100
Entry
Spro_4100         CDS       T00595                                 
Name
(GenBank) conserved hypothetical protein
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: YAcAr Fic_N Mfa1
Other DBs
NCBI-ProteinID: ABV43195
UniProt: A8GJA5
Position
complement(4556540..4557250)
AA seq 236 aa
MKLKYSVIALVLLSPLSQAAQQTAIENSQSTLSELQQSQANKTAQQGKQWGLSGEEYQRY
QQLMDGPRGTQSPGLDPLTALGIEAQSDAERKKYAEQWVKQEFVRTEKELKFQREVDAAW
QRLGVLPVNMGNAAGIAHDTGGRLALFVKAKDCGQCDARLAAVLVDNRPVDIYLVDSKGN
DSLLRDWARAHHIPIDKVRARQITLNHDGGRWMKFGNGLMPVVLQQGENGWTLAAF
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaaactgaaatacagcgtgattgcccttgtgctgctgagcccgttatcacaggcggcg
caacagacggccatagagaacagtcagtctaccctgagtgagcttcagcagagccaggcc
aacaaaacggcgcagcagggcaagcagtggggactcagcggggaagagtaccagcgttac
cagcagttgatggatggcccccgcgggacccaatctccggggcttgatccgttaaccgcc
cttggtattgaggcgcagagcgacgccgaacgtaaaaagtacgctgagcagtgggtgaag
caggagtttgtccgcaccgagaaagaactcaagttccagcgtgaggtggatgcggcctgg
caacgcctgggcgtgctgccggtcaatatgggcaacgccgcgggtattgcccacgacacc
ggcgggcggctggcgctgttcgtgaaagcgaaggactgcggtcagtgtgatgcgcgactg
gcggcggtgctggtagataaccggccggtcgatatttacctggtcgacagcaagggaaat
gacagcctgctgcgtgactgggcccgggcgcatcacattcccatcgacaaggtgcgtgca
cgtcaaatcacgttgaatcacgacggtggccgctggatgaaattcggcaacggcctgatg
ccggtggtgctgcagcaaggggaaaacggatggacactcgccgcattctga

DBGET integrated database retrieval system