KEGG   Serratia proteamaculans: Spro_4102
Entry
Spro_4102         CDS       T00595                                 

Definition
(GenBank) type IV B pilus protein
Organism
spe  Serratia proteamaculans
SSDB
Other DBs
NCBI-ProteinID: ABV43197
UniProt: A8GJA7
Position
complement(4558001..4558621)
AA seq 206 aa
MKKTILVSSLAALMLTGCVTQQPLQQRDISPVTPSVTVNRNVQPVSPDAYGQAPEVVRYD
RYLLVSTDPAAVQRDPLSQIIDIRIPASVKPTVADALRYALRQSGYSLCATGPANGVLYR
QALPAVQYQLGPMRLRTALQVLAGPAWQLEVDDVQRVVCHSLRDGYQLPATQLPSVTVAP
SARPAATVIAPQAVNAVPATGGWLKK
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaaaaaaacaattctcgtctcttccctggcagcactcatgctgaccgggtgcgttact
cagcaacctttgcagcagcgtgatatttcccctgttacgccgtctgtcaccgtcaatcgc
aatgtccaaccggtcagcccggatgcctacgggcaggcgccggaggtggtgcgctacgac
cgttatttactcgtcagcactgaccccgcggctgttcagcgtgatccgctctcgcaaatc
atcgatatccgtattccagcgtcagtaaaaccgacggtggcggatgcgttgcgttatgcg
ctgcgccagtcgggttattccctgtgcgcgaccggaccggcaaacggcgtgttgtaccgc
caggcgttgccggcggtgcagtaccaactggggccgatgcgtttgcgtactgcgctgcag
gtactggcaggccccgcgtggcagctcgaggtcgacgacgtgcagcgtgttgtctgccac
agcctgcgtgatggctatcagttgccggccacacagcttccgtcagtgacggtggcacca
tcagcacgtcctgcggcgacggtcattgcgcctcaagccgttaacgcggtaccggcaacc
ggcgggtggttgaaaaaatga

DBGET integrated database retrieval system