KEGG   Serratia proteamaculans: Spro_4161
Entry
Spro_4161         CDS       T00595                                 

Definition
(GenBank) conserved hypothetical protein
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: ABV43255
UniProt: A8GJG5
Position
complement(4615842..4617365)
AA seq 507 aa
MMTNSYLEYFLTLLGWLINNGLWELLVSTGLFVLPLLFKVAAIWLKVREEGEDEGNKGML
SLPRIENLLYGAFFVMLTCCLPLMNVSLDTIKYDSSRAATCGTWTPKKPDETGYANIMSS
MNGQTAKVPVWWLVVHKLSKGITSAAVATIPCRPDLRQVRFEVQHSRVNNPALAKELQDF
TNDCYALALYTWQNRDQGQTTDKATLRDIEWLGSKTFLNGGYYNNLQSKTPRASFPWNEA
RDSGRPNTGRGGYPTCSEWWSAGEKSLEVRLVKQVDPGVMLRMSAALKMMGQSDADYKEA
VVRRLVSPDNLTISQGGRAYAGYGGNADFTLDNSVNRIASMGGTALGSLAAYPAFDAMRQ
ALPMVQAVLLMAVYIMVPLILAFAAYEYKTVITVTFVVFALNFLTFWWELARWLDSWLLE
ALYDSDTHSRWNVAGFQNSTDDVIMNLVMGCMFIVLPIVWMGALSWAGVNVGHAIASAVN
SGTETAKNTGGKFGDTAGNIIAGKATQ
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgatgaccaacagctatctggagtatttcctgacgctgctcggctggttgattaacaac
ggtctgtgggagctgctggtcagtacggggctgtttgtgctgccgctgctgttcaaggtg
gcggccatctggctgaaggtccgggaggaaggtgaggatgagggcaacaaagggatgctg
tccctgccgcgcatcgagaatctgctctacggcgcgttttttgtgatgcttacctgctgc
ctgccgctgatgaatgtcagcctggataccatcaaatatgacagcagtcgggcagcaacc
tgcggtacctggacacccaaaaagccggatgaaacgggttacgccaacatcatgtcgagc
atgaacggccagacggcgaaggtgccggtgtggtggttggtggtgcataagctgtcgaag
gggatcacgtcggcggcagtggccaccattccgtgccggccggatctgcggcaggtccgt
tttgaggtccagcacagtcgggtcaacaacccggcactggcaaaggagctgcaggacttc
actaacgactgctatgcgctggcgctgtatacctggcagaaccgcgaccagggacagacg
accgacaaggccacgctgcgtgatatcgagtggctggggtcgaaaacctttctgaatggc
ggctactacaacaacctgcagtcgaaaacgccgcgcgccagtttcccgtggaatgaggcg
agggacagcggccggccaaacaccggacggggcggatacccgacctgcagtgagtggtgg
tcagccggcgagaagagccttgaagtcaggttagtgaaacaggtcgacccgggcgtgatg
ctgcggatgtccgctgcgctgaagatgatgggacaatctgacgcggattataaagaagcg
gtggtgcgtcgcctggtcagcccggataacctgactatctcccagggcggacgggcgtat
gccggctacggcggcaacgcggacttcaccttggacaactcggttaaccgtattgcctcg
atgggtggaaccgcactggggagcctggcggcgtatccggcttttgatgcgatgcgtcag
gcgctgccgatggtgcaggcggtactgttgatggcggtgtatatcatggtgccgctcatc
ctggcctttgcggcctacgagtataagacggtgatcacggtgacattcgtggtgtttgcc
ctgaacttcctgacgttctggtgggaattggcgcgttggctggatagctggctgctggag
gcgctttacgactcggatacacacagtcgatggaacgtggccgggttccagaacagtacg
gacgacgtgatcatgaacttggtgatggggtgtatgtttatcgtattgccaatagtctgg
atgggggcactgtcatgggccggtgtgaacgtaggtcatgccattgcttctgcggtaaat
agcggtacagaaacagctaaaaatacagggggaaaatttggagacacagctgggaatatt
atagcaggtaaagcaactcagtga

DBGET integrated database retrieval system