KEGG   Serratia proteamaculans: Spro_4163Help
Entry
Spro_4163         CDS       T00595                                 

Definition
(GenBank) conserved hypothetical protein
Organism
spe  Serratia proteamaculans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParB
Motif
Other DBs
NCBI-ProteinID: ABV43257
UniProt: A8GJG7
Position
complement(4617751..4619235)
Genome map
AA seq 494 aa AA seqDB search
MNNTMNKRTFRGRRSMLSLLVVSSLMLVGMYAHADDNDDNGTLFGISLPQVNDSNIGYGK
NASGAVSDKLFYSLGGGSVISQPATRGNMKRLGMNLGWSSDLMCGNFDLKTTIGNQLNGV
TDGFKNLMGSVIQGATGAVASLPAMAIQRANPGLYEMLTNGVLQGGVAFDKAQLNCQNLS
KRMMDMADTGGWSQAAAMEEAKSLVNNGDADAVRSMNATEKVTGQSGQTWIGGQKRGGSG
QPAIKPTHDLTAAGYNMMNALPVTSTSNVSGSSCTGGACAKYASSEEAAAAVVKVLGDTS
LRTCKDASQCTSGEGSEQPGSTVAGTGFAPMLEEATKANNEQLAKLVNGAEKPTTANLAK
LKTGSLAVTAGVIKALQRDPDNAALVGRLASELAMADTIETAFIMRRMITTGMSEPNASA
QKVAMEEGDRRIEALDREITALKNEMEMKREISRNAVLTIIVRENNRAETNPQRQSVDSP
DTKFNQLAVPESDQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaataacacgatgaataaacgcactttccgaggccggcgcagcatgctgtctctgttg
gttgtcagcagtctgatgctggtcggcatgtacgcgcacgctgacgacaatgatgataac
ggtaccctgtttggcatttcgttgccccaggtgaatgacagcaatatcggttacgggaag
aatgccagcggcgcggtctcggacaagctgttttattccctgggcggtggctcggtgata
tcgcaaccggcgacacgcggcaacatgaaacgcctgggaatgaacttgggctggagctcg
gatttgatgtgcggcaacttcgatctgaaaacgacgatcggtaatcagcttaatggtgtc
accgacggcttcaagaacctgatgggcagtgttatccagggcgccaccggcgcggtggcc
agcctacctgcgatggctatccagcgtgctaacccggggctgtatgaaatgctgaccaac
ggggtgctgcagggcggtgtcgcgttcgacaaagcgcagctgaactgtcagaacctctcg
aagcgcatgatggacatggcggataccggcggctggagccaggcggcagcgatggaggaa
gccaagagtctggtcaataacggggacgcggatgcggtgcgttcaatgaacgcgacggag
aaggtgacagggcaatcggggcagacctggatcggggggcagaagcgaggtggctccggt
cagccggccatcaaaccgacgcacgacctgacagccgccggctacaacatgatgaatgcg
ctgcccgtcaccagcacgtccaacgtatccggcagcagttgcaccggtggagcttgtgcc
aagtatgccagcagcgaagaagcggcagccgcagtggtgaaggtgttgggcgatacctca
ctgcgtacctgtaaggatgcgtctcaatgtaccagtggggaagggagcgaacagcccggc
agtaccgtggccggcacaggttttgctccgatgctggaagaggcgacaaaagcaaataac
gagcagttggccaaactggtcaacggagcagagaaacccaccacggccaacctggccaag
ctcaaaacgggcagcctggcggtgaccgccggggttatcaaggcgctgcagcgtgacccg
gataatgctgctctggtcggccgcctggccagcgaactggcaatggcggataccattgaa
acggcctttattatgcgtcgcatgatcactaccgggatgtccgagcccaatgcctccgca
cagaaagtggcgatggaagagggcgatcgtcgtatcgaggcgctggatcgcgagataact
gcgctgaagaatgaaatggaaatgaagcgcgagatttcccgtaacgcggtgctgaccatt
atcgttcgcgagaacaaccgtgcggaaaccaacccgcagcgtcaatcggttgacagcccg
gacaccaagttcaaccagctggccgtaccggaaagcgaccagtaa

DBGET integrated database retrieval system