KEGG   Serratia proteamaculans: Spro_4172Help
Entry
Spro_4172         CDS       T00595                                 

Definition
(GenBank) conserved hypothetical protein
Organism
spe  Serratia proteamaculans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3438
Motif
Other DBs
NCBI-ProteinID: ABV43266
UniProt: A8GJH6
Position
complement(4627996..4628907)
Genome map
AA seq 303 aa AA seqDB search
MMKARVLALSLSVLPLAATFTVPVTQAEELMKWERIPLQIPLTVGKERVLFADKNVRVGF
PPALNGKLRVQSSGGAVYLKADAAFPSTRLQLQDVENGEVILLDVTASDKGSAEPVRIVY
SGDVSSVSSSNDTPSPSSASSSAAPGTEDGTQAKRKKVRYNAPLPVVLTRYAAQSLYGPV
RTVEAVPGIHPVNPHLPKRITTLYPSESVAITPLGGWGIGSRNVVALKVQNTASRKITLD
PRVLQGQFVTATFQHRYLGPVGTPEDTTTLYLVTAGRPDGAFVAEPSVVRKAVKAAKKGA
NHG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagcacgtgttctggcgctttccctgagtgtgcttcccctggcggcaacgttc
acggtgccggttacgcaggcggaggagctgatgaaatgggagcgcatcccgttacaaatc
ccgctgaccgtcggcaaggagcgggtgctgtttgccgataaaaatgttcgcgtcggtttc
ccgccggcgctgaacggcaagctgcgggtgcaaagcagtggtggtgcggtttacctgaaa
gccgatgccgcattcccgtcaacgcgtctgcaactgcaggacgtcgaaaacggggaggtc
atcctcctcgacgtgacggcatccgataaaggttccgccgaaccggtgcgcattgtctac
agcggtgatgtgtcgtcggtcagcagcagtaatgataccccgtccccatcaagcgcgagt
agttcggctgcgcctggaacggaggatggcacccaggcgaagcgcaaaaaagtcagatac
aacgcgccgttgccggtggtgttgacacgctacgcggcacaaagcctgtacggcccggtg
cgcacggttgaagcggtgccgggcattcacccggtcaacccgcacctgccaaaacgcatc
accaccttgtacccgtcagagtcggtggccatcacgccgctgggcggctggggtattggc
agtcgcaatgtggtggcgctaaaagtgcagaacaccgccagccgtaaaatcacgctggat
cctcgggtgctgcaggggcagttcgtgacggccaccttccagcaccgttatctggggccg
gtggggaccccggaagacactaccacgctgtacctggtcacggccggtcgcccggacggg
gcgtttgtcgcggagccgtcggtggttcgcaaagcggtgaaggcagcgaagaagggagca
aaccatggctga

DBGET integrated database retrieval system