KEGG   Serratia proteamaculans: Spro_4173
Entry
Spro_4173         CDS       T00595                                 

Definition
(GenBank) conserved hypothetical protein
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ABV43267
UniProt: A8GJH7
Position
complement(4628904..4629575)
AA seq 223 aa
MSHFRHAVKNRDQHILTLRVACGVLVVFLLVASIGWMRAPENLTIHNPPDLRSGSTRAWW
EVPPSTVYSFGFYIFQQLNAWPKNGEVDYPAKINGLSPYLTPSCERFLKADAKKRSESGE
LAGRTRVVFEIPEHGYNGRYNQSPVTVKGRDNWVVRLDLVADESFAGEPVKRALTRYPLK
VVRAEGDPERNEFGLALDCYDSMPQRLAAAPAEPAPEKKGVFQ
NT seq 672 nt   +upstreamnt  +downstreamnt
atgagtcattttagacatgcggttaaaaaccgcgaccagcacattctcacattacgtgtt
gcctgcggtgtgctggttgtttttctcctggtggccagcatcggctggatgcgggctccg
gagaacctgactattcataacccccctgacctgcgtagcggctctacccgcgcctggtgg
gaggttccgccgtcaacagtctacagcttcggcttttatatcttccagcaactcaatgcc
tggccaaaaaacggtgaggtagattacccggccaaaatcaacggcctgtcgccgtacctg
acaccatcgtgtgagcgctttctgaaggcggatgccaaaaagcgcagcgaaagcggcgag
ctcgccggcaggacgcgtgtggtgtttgaaatccctgagcatggctacaacggccgttat
aaccaaagcccggtgacggtgaaaggccgtgataactgggtggtgcgccttgatctggtg
gcagatgagtcctttgccggcgaaccggtgaagcgcgccctgacacgctacccactgaaa
gtggttcgcgcagagggcgacccggaacgtaatgagttcggtctggccctggattgttac
gacagcatgccacagcgtctggctgcggcgccggcggaacccgcacctgagaagaaagga
gtattccaatga

DBGET integrated database retrieval system