KEGG   Serratia proteamaculans: Spro_4206Help
Entry
Spro_4206         CDS       T00595                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
spe  Serratia proteamaculans
Pathway
spe00052  Galactose metabolism
spe00500  Starch and sucrose metabolism
spe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Spro_4206
   00500 Starch and sucrose metabolism
    Spro_4206
Enzymes [BR:spe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Spro_4206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ABV43300
UniProt: A8GJL0
Position
4664087..4665496
Genome map
AA seq 469 aa AA seqDB search
MEELNLMKQAVQALMRDMPKVLRAPHRPAWHLAPSVGLLNDPNGFIQHNGVYHLFYQWNP
LGCDHRNKCWGHWQSTDLVNWQHQPVALVPGACYDSHGCYSGSAVVADGKIMLAYTGNVK
YPDGSRTAYQCLAQENAQGGYDKLGPVLPLPPGYSGHVRDPKVWRHQDDWYMVLGARDLQ
DRGKVLLLRSADLHGWQLLGEIAGSQLNGIGDFGYMWECPDLFTLDGVEILICCPQGLAA
QAEQYLNVYQAGYFTGKLDYRQASFEHGAFHELDLGFEFYAPQTTQAEDGRRLLVGWMGV
PEQDEDYHPTLQYGWIHILTCPRELSLHQGKLYQQPARELQQLRGESRQWQGIADEAPCW
PVGSAELLLTPEGAFSADFGGAMTLLWDGALLRLTRNNLRNGQPEHRYWRGNLSQLQILF
DRSSVEIFINHGEAVMSARYFPGPQPQLHLSGKTQLALEHWSLTPCMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaagaattgaatttgatgaaacaggccgttcaggcgttgatgcgcgacatgccaaag
gtactgcgtgcgccgcaccgcccggcgtggcatctggcgcccagcgtcgggttgctcaac
gatcccaacggattcattcagcataacggcgtctaccatctgttctatcagtggaacccg
ctgggttgcgatcaccgcaacaagtgttggggccattggcagtcgacggatctggtcaac
tggcagcatcagccggtggcactggtgccgggagcctgctacgacagccacggctgttat
tccggatcggcagtggtggcggacggcaaaatcatgctggcgtataccggcaacgtcaaa
taccccgacggctcccgcaccgcctaccagtgcctggcgcaagaaaatgcccagggtggc
tatgacaaacttggcccggtattaccgctgccgccgggctatagcggccacgtgcgcgat
ccgaaggtttggcgtcatcaggacgactggtacatggtgctcggcgctcgcgacctgcaa
gaccgtggcaaagtgctgctgttgcgctccgccgatctgcacggttggcagttgctggga
gagattgccggttcacagctgaacggcatcggcgatttcggctatatgtgggaatgcccg
gacctgttcacactggacggggtcgagatactgatctgttgcccacaggggctggcggcg
caggccgagcagtatctcaacgtttatcaggcgggctatttcactggcaaactggattat
cggcaggccagtttcgaacatggtgccttccacgagctggatctcggcttcgaattctat
gcgccacagaccacccaggccgaagacggccgccggttgctggtcggctggatgggcgtg
ccggagcaggacgaggattatcacccgacgctgcagtacggctggatccacatcctgacc
tgcccgcgcgaactgtcgctgcatcagggcaagctttaccaacaaccggcgcgcgaactg
caacaattgcgcggtgaaagccggcaatggcaggggatcgccgacgaagcgccatgttgg
cccgtcggcagcgcggaactgctgctaacgccagaaggggcattcagcgccgattttggc
ggggcaatgacgctgctctgggacggtgccttgctacgactgacgcgcaataatctgcgt
aacgggcaaccggaacatcgctactggcgcggcaacctgagccagctgcagatcctgttt
gaccgctccagcgtggagatttttatcaaccacggcgaggcagtgatgagcgcacgctac
ttccccgggccgcaaccacaactgcacctgagcggtaaaacccaactggcgctcgagcac
tggtcgctgacgccatgcatgctagaatga

DBGET integrated database retrieval system