KEGG   Serratia proteamaculans: Spro_4502Help
Entry
Spro_4502         CDS       T00595                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
spe  Serratia proteamaculans
Pathway
spe00630  Glyoxylate and dicarboxylate metabolism
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01120  Microbial metabolism in diverse environments
spe01200  Carbon metabolism
Module
spe_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Spro_4502
Enzymes [BR:spe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Spro_4502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: ABV43596
UniProt: A8GKF6
Position
complement(4989151..4990458)
Genome map
AA seq 435 aa AA seqDB search
MSTSRAQQIQQLEQEWKSARWEGITRPYSAEDVINLRGSVNPVCTLAQNGAAKLWELLHG
KSRKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANTASAMYPDQSLYPVDSVPG
VVERINNTFRRADQIQWANKIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLVIARTDADAAD
LLTSDCDPYDREFVSGERTAEGFFRTHAGVEQAISRGLAYCPYADLVWCETSTPDLQAAK
RFADAIHAKFPGKLLAYNCSPSFNWKKNLDDQTIARFQEELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFDAVSRGYTFASHQQEVGTGYFDKVTTIIQGGA
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctctcgtgctcaacagattcaacaactggaacaggaatggaaatcggctcgc
tgggaaggcatcacccgcccgtacagcgcggaagacgtcattaacctgcgcggttcggtt
aacccggtttgcaccctggcacagaacggtgccgccaaactgtgggaactgctgcacggt
aaatcacgcaaaggctacgtcaacagtctgggggcgctcactggcggccaggcactgcag
caggccaaggccggcatcgaggcgatttacctgtccggttggcaggtggcggcggatgcc
aacacggcgtctgcgatgtacccggaccagtcgctgtacccggttgactctgtgccgggt
gtggttgagcgcatcaacaacaccttccgccgcgccgaccagatccagtgggccaacaaa
attgagccgggcagcaaaggttacaccgactacttcctgccgatcgtcgccgatgccgaa
gccggctttggtggcgtgctgaacgctttcgaactgatgaaggcgatgattgaggccggt
gctgccggggtgcacttcgaagaccaactggcggcggtgaaaaagtgcggtcatatgggc
ggcaaagtgctggtgccaacccaggaagcgatccagaaattggttgctgcgcgcctggcg
gccgatgtgctcggcgtgccgacgttagtcatcgcacgtaccgatgccgatgccgccgat
ttactgacttctgactgcgacccgtacgaccgcgagtttgtgtccggtgagcgcactgcc
gaaggtttcttccgcacccatgccggtgtcgagcaagcgatcagccgtggcctggcatat
tgcccttacgctgacctggtgtggtgcgaaacctccacgccggatctgcaggcggccaag
cgctttgccgatgcgatccatgccaaattcccgggcaaactgctggcgtacaactgctcg
ccgtcattcaactggaaaaagaacctggacgaccagactattgctcgcttccaggaagag
ctgtcggcgatgggctacaagtaccagttcattacgctagcgggcatccacagcatgtgg
ttcaacatgtttgacctggcgcatgcctatgcacagggcgaaggcatgaaacactacgtc
gaaaaagtgcagcagccagagttcgacgcggtgtctcgcggttatacctttgcctcacac
caacaggaagtgggtaccggttacttcgacaaggtgaccaccattattcagggcggtgct
tcctcagtgacggcattgaccggttctacggaagaacagcagttctga

DBGET integrated database retrieval system