KEGG   Serratia proteamaculans: Spro_4857Help
Entry
Spro_4857         CDS       T00595                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spe  Serratia proteamaculans
Pathway
spe00071  Fatty acid degradation
spe00072  Synthesis and degradation of ketone bodies
spe00280  Valine, leucine and isoleucine degradation
spe00310  Lysine degradation
spe00362  Benzoate degradation
spe00380  Tryptophan metabolism
spe00620  Pyruvate metabolism
spe00630  Glyoxylate and dicarboxylate metabolism
spe00640  Propanoate metabolism
spe00650  Butanoate metabolism
spe00900  Terpenoid backbone biosynthesis
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01120  Microbial metabolism in diverse environments
spe01130  Biosynthesis of antibiotics
spe01200  Carbon metabolism
spe01212  Fatty acid metabolism
spe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spro_4857
   00630 Glyoxylate and dicarboxylate metabolism
    Spro_4857
   00640 Propanoate metabolism
    Spro_4857
   00650 Butanoate metabolism
    Spro_4857
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Spro_4857
   00072 Synthesis and degradation of ketone bodies
    Spro_4857
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spro_4857
   00310 Lysine degradation
    Spro_4857
   00380 Tryptophan metabolism
    Spro_4857
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spro_4857
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Spro_4857
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Spro_4857
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spe04147]
    Spro_4857
Enzymes [BR:spe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Spro_4857
Exosome [BR:spe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spro_4857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABV43950
UniProt: A8GLG0
Position
complement(5378488..5379666)
Genome map
AA seq 392 aa AA seqDB search
MRDAVIVSTARTPIGKAYRGAFNATPSATLAGHAIKHAVERAGILGSEVDDVLLGSALQQ
GVQGLNIGRLAALRAGLPTSVSGMSLDRQCASGLMAVATAAKQIIVDGMSIAVAGGVESI
SMVQTDRIRIEPDMELFALYPAAYMQMVDTADIVAKRYEISREACDEYSLRSQQRTAAAQ
LEGLFDKEIVPMRSLMAYNDQETGVLAYKEVLLERDEGNRPQSTLEDLQALYSVKGPGKN
VTAGNASQLSDGASALVLMEAKEAERRGLQPLGRYVGMAVAGVDPDEMGIGPVAAVPKLL
HSNGLKIDDIGLWELNEAFAVQVLYCRDRLGIPDDRLNVNGGAIAIGHPYGMSGARMTGH
ALIEGKRRGERYAVVTMCIGGGMGAAGLFEIY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgccgttattgtttctacagcccgaactccgattggcaaagcctatcgtggc
gctttcaatgccaccccatctgcaacactggctgggcatgcaattaagcatgctgtcgag
cgagcaggaattttaggtagtgaagtggatgatgtgttactcggttcagccttgcagcaa
ggtgtgcaaggtttgaacattggccgcctggctgcattgcgggccgggttgcccacgtca
gtttcaggtatgtcgttggatcgccagtgcgcctcgggtcttatggctgttgccacggct
gccaaacaaatcattgtcgatggtatgagcattgccgttgcgggaggtgtggaatccatc
tcgatggtgcagactgaccggatacgcattgagccggatatggagcttttcgcgctgtat
ccagctgcatatatgcaaatggtggatacggctgacatagtggcaaagcgctatgagatc
agccgggaagcctgtgacgaatactcgctgcgctcccagcaacgaacggcagcagcacaa
ttagaagggctgttcgacaaggaaattgttcctatgcgttctttgatggcctacaacgat
caggaaaccggcgtattggcttataaagaggtattgctggagcgtgacgaaggcaatcgc
ccacaaagtacccttgaggatttgcaggctctctattccgtcaaaggacctggcaaaaat
gttaccgccggcaacgccagtcaactctccgatggtgcctcagcgctagtgctgatggaa
gccaaagaggccgaacgaaggggcctgcagccgttaggtcgctatgtaggtatggccgta
gcgggtgttgatccggacgagatgggaattggcccagtggcggcggtgcctaaattgctg
catagcaatggtctaaagattgatgatatcggattatgggagctcaatgaggcatttgca
gtacaagtactctattgccgagaccgactgggcattccggacgacaggctgaacgtgaac
ggcggcgcaattgcaatcgggcacccctacggcatgtccggcgcccgtatgacaggccat
gcgctgatagaaggaaagcgtagaggcgaacgctacgccgtagtgacgatgtgtatcggt
gggggaatgggggcagcgggtttattcgaaatttattga

DBGET integrated database retrieval system