KEGG   Solanum pennellii: 107004882Help
Entry
107004882         CDS       T04130                                 

Definition
(RefSeq) phosphatidylinositol-3-phosphatase myotubularin-1 isoform X1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
spen  Solanum pennellii
Pathway
spen00562  Inositol phosphate metabolism
spen01100  Metabolic pathways
spen04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107004882
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107004882
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spen01009]
    107004882
Enzymes [BR:spen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     107004882
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     107004882
Protein phosphatases and associated proteins [BR:spen01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    107004882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase Y_phosphatase3 Fez1 HAUS-augmin3
Motif
Other DBs
NCBI-GeneID: 107004882
NCBI-ProteinID: XP_015058767
Position
11
AA seq 850 aa AA seqDB search
MYRSRSARSSSLREPESRLSESDKIEGAGSWDALEWTKIDPVARSIPIGVKQFLLEAEQV
IVEGYGVVLVNTDDAGTLYVTNFRLLFLSEGSRDIITIGTIPLATIEKFQKIAVKLPSGP
RQPEKSRSQRLLQIIGKDMRIIVFGFRARTKQRRAVYDALLRCTRPATLWDLYAFAGGPS
RFSNTNPKVRLLNEYCRLLGMGFYQASIRAIEDGAFTLSNEWWRISSVNCNYTMSSTYPF
ALLLPKSISDDKVVQASAFRARSRLPSITWCDRGTGAVLARSSQPLVGIMMNMRSNADEN
LVAALCTQIAGQKRRKLYIADARPRKNALANGAMGGGSESSANYFQSEIVFFGIDNIHAM
RESLGRLRDYVDTYGTTSSDGMSSYLRHGGWSWGGGNLSSMSASVSTLGDTGWLIHVQTV
LAGSAWIAARVALESASVLVHCSDGWDRTSQLVSLASLLLDPYYRTIRGFQALVEKDWLA
FGHPFSDRLGMPTVSGNGNMPFELSRQASTGSLPLSPMRQGSGSASTQAQNTANANHSSP
IFLQWVDCVSQLLRMYPFAFEFSSAFLVDLLDCMLSCRFGNFLCNSEKEREQAGIYDACG
CLWMYLAGLRTSEGSSHAHYNLFYDPLKHNGPILPPAAALAPTVWPQFHLRWACPSEAQG
GEVEAECRKLTRKFSELQRAKELAETRLNEASVTVESLVTELRNEKLASTSARDAVKRAS
KETATIKRAVQSLGFNVYFTADGDCNVGIERNPTEIPQRSICSVRTKDINGTVSHSEKAD
LSEPVSVAEDNVSDNPLIRVCGSLCPMHTRDGECQLPNAGCAQFQSQLVDFKANFDAFDR
LSIYDSYFGS
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgtatcggagtcggtcggcgcgatcctcatcactccgggagccggagagtcgactctct
gagtccgacaaaattgaaggtgccggtagctgggatgcccttgaatggaccaaaatcgat
cctgttgcgaggtcgattcctattggagttaaacagtttttgttggaagccgagcaagtt
atagtagagggttatggggtagttcttgtcaacactgatgatgctggaaccttatacgtg
actaattttcgcctcctattcttgagtgaagggtctagagatatcatcacaattggcaca
ataccgttggcaaccattgaaaagttccagaaaattgctgtgaagcttccatcaggtcca
cgtcaacctgaaaagagtagatcacagcgattgcttcagatcatcggcaaagatatgaga
atcatcgtgtttggttttcgtgctcgaaccaagcagaggcgtgctgtctatgatgcatta
ttacggtgtacaaggcctgcaactttatgggatctctatgcatttgctggtggtccatcc
aggtttagtaacacaaatcccaaagtgaggctgttgaatgagtattgccgacttcttgga
atggggttttatcaagcttctatccgtgctattgaagatggggcatttacactttcaaat
gagtggtggcgtattagcagtgtcaactgtaattacacaatgtccagtacttatccattt
gctttactcttaccgaagtccataagtgatgacaaagtggtgcaggctagtgcattccgt
gcacggagtaggcttccatccataacatggtgtgatagaggaactggggctgttcttgca
cgatcttctcaacctctagttggaatcatgatgaatatgagaagcaatgctgatgaaaat
ctagttgctgcactctgtactcaaattgctggacagaaacgaaggaagctatatattgct
gatgcaaggccgaggaaaaatgctttagcaaatggggcaatgggaggtggatcggagtca
tctgcaaactatttccagtcggagattgttttctttggcattgataatatacatgcaatg
agggagagtcttggtcggcttagagactatgtagatacttatggaactacttcatcagac
ggaatgtcatcttatctgaggcatggtggatggagttggggcggaggcaatctcagcagt
atgtcagcttcagtttctactctgggggacactgggtggttaatacatgtgcaaactgtc
ctggctggttctgcttggattgctgcacgtgttgcactagaatcagcttcagtgcttgtt
cattgcagtgatggatgggatagaacatcacaattggtctcacttgccagcttgctactt
gacccatattatcgcacaattagagggtttcaggcacttgtagagaaagattggcttgca
tttggtcatccattttcagatcgtctgggaatgcccactgtatctggaaatggcaacatg
ccatttgaattgtctcgtcaggcttcgactgggagtttacctttatcccccatgcgtcaa
ggatcggggtcagcttcaacccaagctcaaaatacagcaaatgcgaaccatagttccccc
atttttttgcagtgggttgattgtgtttcgcagttgttgaggatgtatccctttgccttt
gagttctcttcggctttcctggtagatcttctggattgcatgctttcttgtcgttttggg
aactttttgtgcaacagcgagaaggaaagagagcaagctggtatatatgatgcttgtgga
tgcctgtggatgtatttagctggactaaggacatctgaaggaagctctcatgcgcattac
aacctattctatgacccactgaaacataatggtcctatacttccaccagcagcagcttta
gctccaactgtgtggcctcagtttcaccttcgttgggcttgcccctcagaggcgcaaggt
ggggaagttgaagctgaatgcaggaagctgacaagaaaattctctgagctgcaaagggcc
aaagaattagcagaaacaagacttaacgaagcaagtgtcaccgtggagtccttagttaca
gaactgagaaatgagaaacttgcaagcacctctgccagggatgcggtaaaaagagcaagc
aaagaaactgctactataaagcgcgcagtacaatctttggggttcaatgtctactttaca
gcagatggagactgtaacgtaggcattgaaaggaacccaactgaaatccctcagcgatct
atctgctcagttcgtacaaaagatattaatggcacagtgtcccacagtgagaaagcagac
ctctctgaacctgtttctgtggcggaagataatgtttccgacaatcctctcatccgagtt
tgtggatctctatgcccgatgcacactagagatggagagtgccagttgccaaatgctggt
tgtgctcagtttcagagccaattggttgatttcaaagccaactttgatgcatttgatcgg
ctttcgatatatgatagttattttggaagttaa

DBGET integrated database retrieval system