KEGG   Solanum pennellii: 107005350Help
Entry
107005350         CDS       T04130                                 

Definition
(RefSeq) (-)-germacrene D synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
spen  Solanum pennellii
Pathway
spen00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    107005350
Enzymes [BR:spen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     107005350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth Ly49 DUF3377 CEP170_C
Motif
Other DBs
NCBI-GeneID: 107005350
NCBI-ProteinID: XP_015059409
Position
12
AA seq 554 aa AA seqDB search
MELCTQTVAADHEVIITRRSGSHHPTLWGDHFLAYADLPGANEGEEKQHEDLKEEVRKML
VMAPSNSLEKLELINTIQCLGLAYHFQSEIDESLSYMYTHYEEYSIGDLHAMALCFRLLR
QQGYYVSCDAFKKFTNDQGNFKEELVKDVEGMLSLYEAAQFRVHGEQILDEALNFTITKL
KQILPKLSNSQLAQQITNALKFPIKDGIVRVETRKYISFYQQNQNHNQVLLNFAKLDFNI
LQTLHQKELSDMTRWWKKMELVNTLPYARDRLVECYFWCLGTYFEPQYSVARKILTKISF
FISIIDDTYDIYGKLDELTLFTQAIERWNIDASEQLPLYMKIIYRDLLDVYDEIEKELAN
ENKSFLVNYSINEMKKVVRGYLQEAKWYYGKKVPKMEQYMKNAISTSAYILLTTTSWLAL
GNVATKDVFDWVATEPPIVVASCHIIRLLNDLVSHEEEQKRGNAASAVECYMKEYSVTKE
EAHVKIRDIIENYWKDLNEEYFKVDMIIIPRVLLMCVINLTRVAEFIYKDEDAYTFSKNN
LKDVISDILVDPII
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggagttgtgtacacaaaccgttgcagcggatcatgaagttataattacacgtcgctct
ggtagtcatcatcctactttatggggtgaccattttcttgcctatgctgatcttccggga
gccaatgaaggggaagagaagcaacatgaagacctaaaagaagaagtgagaaagatgcta
gtgatggctccttcaaattctttggaaaaacttgaacttatcaacacaattcaatgtctt
ggtttagcttatcattttcaaagtgagattgatgaatcattgagttacatgtacactcat
tatgaagaatattcgattggtgatcttcatgctatggctctatgctttcgattacttagg
caacaaggttattatgtctcatgtgatgcatttaagaagttcactaatgaccaaggaaat
ttcaaggaagaattggttaaggatgtagaaggaatgttgagcttatatgaggcagcacaa
ttcagagtacatggagaacaaattcttgatgaagcactcaatttcaccattactaaattg
aaacaaattttgcctaaattgagcaactcccaacttgcacaacaaatcacaaatgcactc
aagtttccaattaaagatggcattgtgagggtagaaacaagaaaatacatatcattttac
caacaaaatcaaaatcacaatcaagtcttactaaactttgccaaactagacttcaacatc
ttgcaaacattgcatcaaaaggagctatctgatatgacaaggtggtggaaaaagatggaa
ttagtgaacacattaccttatgcaagagacagattggtagagtgttacttttggtgttta
ggcacctattttgagcctcagtatagcgttgcaaggaaaatattgacaaaaatttcattc
ttcatttcaattattgatgacacatatgatatttatgggaaactagatgaacttactcta
ttcactcaggcaattgaaaggtggaatattgatgcttcagaacagttaccattatatatg
aagattatttaccgtgatcttttagacgtttatgatgaaattgagaaagagttggcaaat
gaaaacaagtcatttctagtcaattattccataaatgagatgaaaaaggtagtaaggggt
taccttcaagaggcaaaatggtattatggaaagaaagtaccaaaaatggagcaatatatg
aagaatgcaatttcaacaagtgcttacatattgctaacaactacttcttggttagcattg
ggaaatgttgcaactaaagatgtatttgattgggtagcaactgaaccaccaatagttgtt
gcttcttgtcacattataagattactcaatgatcttgtatcacatgaggaagaacaaaaa
cgaggaaatgcggcttctgctgttgaatgttatatgaaagaatatagcgttacaaaggaa
gaagcacacgtaaaaataagagatataatagaaaattattggaaggatttgaatgaagaa
tactttaaagtagatatgattattataccaagagttttgctcatgtgtgtaattaatctt
acaagagtggctgagttcatatataaagatgaagatgcttatactttctccaaaaataac
ttgaaagatgtcatctctgatatactagttgatcctattatatag

DBGET integrated database retrieval system