KEGG   Solanum pennellii: 107005640Help
Entry
107005640         CDS       T04130                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase-like
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
spen  Solanum pennellii
Pathway
spen00072  Synthesis and degradation of ketone bodies
spen00280  Valine, leucine and isoleucine degradation
spen00650  Butanoate metabolism
spen00900  Terpenoid backbone biosynthesis
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Module
spen_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107005640
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    107005640
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107005640
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    107005640
Enzymes [BR:spen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     107005640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 107005640
NCBI-ProteinID: XP_015059767
Position
12
AA seq 462 aa AA seqDB search
MATQRKNVGILAMEIYFPPTCIQQETLEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS
LTAVTSLLEKYAIDPKQVGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC
YGGTAALFNCVNWVESASWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVF
ESKIRASHMAHVYDFYKPILDSEYPVVDGKLSQTCYLVALDSCYKILCNKYEKLEGKRFS
IADAAYFVFHSPYNKLVQKSFARLVFNDFTRNASSIDESAKEKLAPFSCLSHDESYQSRD
LEKASQQVAKPFYDEKVQPTTLIPKQVGNMYTASLYAAFASLLHNKHKTLAGQRVVLFSY
GSGSTATMFSLKLNEGQHPFSLSNIASVMNVEEKLESRNELTPEKFVEIMKLMEHRYGAK
DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKAAENGLANGH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcaacggaagaatgtcggaatcctcgccatggaaatttactttcctcctact
tgcattcaacaggaaacgttggaagctcatgatggagcaagcaaagggaaatacacaatt
ggtcttggacaagattgcatgggattttgtactgaggtggaagatgtaatatcaatgagt
ttgacagctgttacttctcttctcgagaagtatgcgattgatccaaagcaagttggtaga
ctggaagttggaagtgagactgttattgataaaagcaaatctatcaagacgttcctgatg
caaatatttgagaaatgtggtaatactgacatcgaaggagttgactcaactaatgcatgc
tatggtggaactgctgcattattcaactgtgtgaattgggtggagagtgcgtcatgggat
ggacgctatggacttgttgtatgcacagatagtgcggtctatgctgagggacctgctagg
ccaacgggaggcgcagctgccattgctatgctaattggccctgatgctcctattgtgttt
gaaagcaagatcagggctagtcatatggctcatgtctatgatttttacaagcccatccta
gacagcgaatatccagtggttgatggcaagctttcacaaacttgttatcttgtggcactt
gattcttgctataagatcttatgcaacaaatacgagaaattggaaggcaaacgattctcg
atagctgatgcagcttactttgtgttccattcaccgtataacaagcttgtacagaagagc
ttcgctcggttggtattcaatgactttacgaggaatgctagctccatcgatgaatctgct
aaagaaaagctggccccattttcgtgtctaagtcatgatgaaagctaccaaagccgtgat
cttgagaaggcatcccagcaagttgcaaaaccattttacgatgagaaggtgcaacctacc
acattaataccaaaacaagttggcaacatgtatactgcctctctatatgctgcttttgca
tcactccttcacaataaacacaaaacactggctggacaacgggtagttctgttctcctat
ggtagtggatcaaccgcaacaatgttctccctcaagcttaatgaaggtcaacatcctttt
agcttgtcaaacattgcaagtgtgatgaatgttgaagagaaattggaatcaagaaacgag
ttgactcctgaaaagttcgtcgaaattatgaaactaatggagcataggtacggggccaag
gacttcgttacgagcaaggattgtagccttctagctccaggtacctactaccttacagag
gttgattcaaagtatagaagattttatgccaagaaagctgctgagaatggactggccaat
ggtcattga

DBGET integrated database retrieval system