KEGG   Solanum pennellii: 107007504Help
Entry
107007504         CDS       T04130                                 

Definition
(RefSeq) ornithine carbamoyltransferase, chloroplastic-like
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
spen  Solanum pennellii
Pathway
spen00220  Arginine biosynthesis
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
spen01230  Biosynthesis of amino acids
Module
spen_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107007504
Enzymes [BR:spen01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     107007504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N cEGF YqfD
Motif
Other DBs
NCBI-GeneID: 107007504
NCBI-ProteinID: XP_015061637
Position
12
AA seq 379 aa AA seqDB search
MAAIFSQLSSLCSPENLSFSSVYTLSHSGKQSSHFSGVISPSPVTFPAIRQRISCQTTSS
AAAPSSSVIAKGTANQKDFLHINDFDKITILNILDRAREVKEFLKSGERTYLPFKGKTMA
MIFAKPSMRTRVSFETGFYLLGGHAIYLGPNDIQMGKREETRDVARVLSRYNDIIMARVF
AHQDILDLAKYATVPVINGLTDYNHPCQIMADALTMIEHVGQLEGTKVVYVGDGNNIVHS
WLLLAAVIPFHFVCACPKGFQPDQNTVEKARQAGVSKIEITNDPKEAVKDADVVYADVWA
SMGQKEEAAHRRQVFQGFQVDEQLMKLAGKKAYFMHCLPAERGVEVTDGVIEAPNSIVFP
QAENRMHAQNAIMLHVLGL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggccgccattttctctcagttatcttctctctgttcaccggaaaacctctccttctcc
tccgtttacactctctcccactccggcaagcaatcgtctcacttttccggtgtaatctca
ccttctccggtcacatttccggcgatacgtcaacgcatctcatgccaaaccacctcttca
gctgcagctccttcttcctcagttattgcaaaaggaactgccaatcaaaaggactttcta
cacattaatgatttcgataaaatcactattttgaacatcttggatcgagccagagaggtt
aaagagttcctaaaatcaggagagaggacatatctcccattcaagggtaaaactatggcg
atgatttttgctaagccttccatgaggacacgtgtttcttttgagacaggtttttacttg
cttggaggacatgcaatctatttgggaccaaatgatatacagatgggtaagcgggaagaa
actcgtgatgttgcccgtgttctttctcgctataatgatatcattatggctagagttttt
gctcatcaggacattcttgatctagctaaatatgcaactgtgcctgtgatcaatggcttg
acagactataaccatccttgtcaaataatggctgatgcccttacaatgattgaacatgtc
ggccagctggaaggaactaaggttgtctatgttggagatggaaataacatagtgcattcg
tggctgcttctggctgcggtgattccattccactttgtttgcgcctgccctaaaggtttt
caacctgatcagaatacagttgagaaagcacgacaagctggagtcagcaaaatcgagata
actaatgatccaaaagaagctgttaaagacgctgatgttgtctatgcagatgtttgggcc
agtatgggacaaaaggaagaagccgcacatcgccgccaagtatttcaaggattccaggtg
gatgaacaacttatgaaactagctggaaaaaaagcgtactttatgcattgtttgcctgca
gaaagaggagtggaagttactgacggtgtgatcgaagcaccaaactccattgtgttccct
caagctgagaatcgcatgcatgcgcaaaatgcaataatgcttcatgttcttggcttgtaa

DBGET integrated database retrieval system