KEGG   Solanum pennellii: 107008034Help
Entry
107008034         CDS       T04130                                 

Definition
(RefSeq) glutathione synthetase, chloroplastic
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
spen  Solanum pennellii
Pathway
spen00270  Cysteine and methionine metabolism
spen00480  Glutathione metabolism
spen01100  Metabolic pathways
Module
spen_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107008034
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107008034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spen04147]
    107008034
Enzymes [BR:spen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     107008034
Exosome [BR:spen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107008034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 107008034
NCBI-ProteinID: XP_015062409
Position
1
AA seq 546 aa AA seqDB search
MGSGCSSPSISLTTIATSPFQSQESLSNSLNFYSPTRFLEPHLLKSSKIFIPKFPLKCAK
VPKMQTQLEDSAKPIVDPHDIDSKLVQKLANDALVWCSLRGLLVGDRNSERSGTVPGVDM
VHAPVALIPMSFPESHWKQACEVAPIFNELVDRVSQDGEFLQQSLSRTRKADPFTSRLLE
IHSKMLEINKIEEIRLGLHRSDYMLDEQTKLLLQIELNTISSSFPGLSCLVTELHRSLLQ
QYREDIASDPNRIPANNAVNQFAEALAKAWNEYGDPRAVIIFVVQAEERNMYDQHWLSAS
LRERHQVTTIRKTLAEIDALGELQQDGTLVVDGQAVAVIYFRAGYAPSDYHSESEWKARL
LMEQSRAVKCPSISYHLAGSKKIQQELAKPNVLERFLENKDDIAKLRKCFAGLWSLDESD
IVKDAIERPELYVMKPQREGGGNNIYGEDVREALLKLQKEGIGSDAAYILMQRIFPKISH
SILMREGISHKEETISELGIYGTYLRNKTEVLINQQAGYLMRTKVSSSDEGGVAAGFAVL
DSIYLV
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcggctgttcttctccatcaatctcactaactaccatcgctacctctcctttt
caatcccaagaatcactatcaaactctttaaatttctactcacctactagattcttggaa
ccccatctccttaaatcttccaagattttcatacccaaattcccattgaagtgtgctaaa
gtgcccaaaatgcagacccaactggaagattctgcgaaacccattgtcgatcctcatgat
atcgactcaaaattggtgcagaagcttgctaatgatgcccttgtctggtgctctcttcgt
ggacttcttgttggtgacagaaattcggagaggtcaggaactgttcctggtgttgatatg
gttcatgctccagttgctctcataccaatgtcatttcctgaaagtcattggaagcaagct
tgtgaagttgctcctattttcaatgaactcgtggatcgcgtgagtcaggatggagaattt
ctgcagcaatcactgtctaggacgagaaaagctgatccttttacctccagactactagaa
atccactccaagatgttagaaatcaacaagatagaggaaatacgcttggggttgcatcgc
tcagattatatgctggatgagcaaacgaaattacttttgcaaatagagcttaacacaatc
tcatcatcatttccggggctaagttgtctggtcaccgaacttcacaggagcttgcttcaa
caatacagagaagacattgcatcagatcctaacagaattcccgcaaacaatgctgtaaat
caatttgctgaagcattggctaaagcttggaatgaatatggtgatccaagggctgtgatt
atttttgtggttcaagctgaagagcgcaatatgtatgaccagcattggctttctgcatca
ttgagagaaagacatcaagttacaactatcagaaagacgctggctgaaattgatgcactt
ggcgagcttcaacaagatggtacccttgttgtagatggtcaagctgtggcagtcatttat
tttagagctggctatgcaccaagtgactatcactcggaatctgagtggaaagctaggctg
ctgatggagcaatcacgtgcagtcaagtgcccttcaatttcttatcatttagctggcagc
aagaagatccagcaagagcttgcaaagcccaatgtacttgaaaggtttctggaaaacaaa
gatgacattgccaaactacggaaatgctttgcagggttgtggagcttggatgaatccgac
attgtcaaggatgcaattgagaggcctgaattgtatgttatgaaaccacaacgagaagga
ggaggaaacaatatctatggggaggatgtcagagaagctcttttgaaactgcaaaaggaa
ggcattggaagtgatgcagcctacatactaatgcagaggatttttccgaagatctctcac
tcgatactaatgcgagaaggcatctctcataaagaagaaaccatatcagaacttgggata
tatggtacctatttaaggaacaaaacagaagttctaatcaaccagcaggctggttacttg
atgcgaacaaaggtctcttcatcagatgaggggggagttgcagcagggtttgcagttttg
gacagtatttacttggtttga

DBGET integrated database retrieval system