KEGG   Solanum pennellii: 107011350Help
Entry
107011350         CDS       T04130                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 1, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
spen  Solanum pennellii
Pathway
spen00630  Glyoxylate and dicarboxylate metabolism
spen00710  Carbon fixation in photosynthetic organisms
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
spen01200  Carbon metabolism
Module
spen_M00165  Reductive pentose phosphate cycle (Calvin cycle)
spen_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
spen_M00532  Photorespiration
spen_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107011350
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107011350
Enzymes [BR:spen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     107011350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 107011350
NCBI-ProteinID: XP_015066301
Position
2
AA seq 181 aa AA seqDB search
MASSIVSSAAAATRSNVAQASMVAPFTGLKSSASFPVTKKNNNVDITSLASNGGRVRCMQ
VWPPINMKKYETLSYLPDLSDEQLLKEIEYLLKNGWVPCLEFETEHGFVYRENNSSPGYY
DGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG
Y
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcaattgtctcatcggcagccgctgctacccgtagcaatgttgctcaagct
agcatggtcgcacccttcaccggactcaaatcctccgcgtcttttcccgttaccaagaag
aacaacaacgttgacattacctcccttgctagcaatggtggacgtgttagatgcatgcag
gtgtggccaccaatcaacatgaagaaatacgagacattatcataccttcctgacttgtcc
gatgagcaattgcttaaggaaattgagtatcttttgaaaaatggatgggttccttgcttg
gaattcgagactgagcacggatttgtgtaccgtgagaacaacagttccccaggatactac
gatggtagatactggaccatgtggaagttacctatgtttgggtgcactgatgcaacacag
gtgttggctgaggttcaagaggcgaagaaggcgtacccacaagcctgggttcgtattatc
ggattcgacaacgttcgtcaagtccagtgcatcagcttcattgcctacaagccagaagga
tactaa

DBGET integrated database retrieval system