KEGG   Solanum pennellii: 107011431Help
Entry
107011431         CDS       T04130                                 

Definition
(RefSeq) geranylgeranyl pyrophosphate synthase, chloroplastic-like
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
spen  Solanum pennellii
Pathway
spen00900  Terpenoid backbone biosynthesis
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Module
spen_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    107011431
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:spen01006]
    107011431
Enzymes [BR:spen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     107011431
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     107011431
    2.5.1.29  geranylgeranyl diphosphate synthase
     107011431
Prenyltransferases [BR:spen01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   107011431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt EF1_GNE
Motif
Other DBs
NCBI-GeneID: 107011431
NCBI-ProteinID: XP_015066424
Position
2
AA seq 372 aa AA seqDB search
MSMLKRVIYNLVKLSTRGTPNRFRSAGTKLLLSSEETAEVMFRPKARAFCNSKGFSKNES
EVINHEDILGEAGKTTSVFDFKSYMVQKIKSVNQALDAAVPIREPIKFHEAMRYSLLSEG
KRICPVLCIAACELVGGQESTAMPAACGMEMIHAMCMMHDDLPCMDNDDLRRGKLSHHKV
YGENVTVLAGYSLVALAFQHMTTATKGVHPKTMARAVGELARLIGPEGAAAGQVLDLLCG
GNSDTGLEELEYIHRHKTADFAEAAAVVGAMIGGASEKEINRLEKFSKCLGLLFQVVDDI
LDVTKSSEQLGKTAGKDLLANKLTYPKMIGIDKSKEYAQKLNKEAKEQLVGFDPEKSAPL
LAMADFVLHRQK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgctaaaaagagtaatctacaatcttgtgaaactgagtacaagaggcactcca
aatagattcagatctgcaggaacaaagttgcttctttcttcagaggaaacggcagaggtt
atgttccggccaaaagcaagagccttttgtaatagcaaaggtttttccaagaatgaaagt
gaagttatcaaccatgaagacatactcggagaagctggaaaaacaacaagtgtctttgat
ttcaaaagttacatggttcaaaagatcaaatccgtcaatcaagccttagatgctgctgtt
ccaatcagagagcctatcaagttccatgaagcaatgagatactcactcctttctgaaggc
aagcggatttgtcctgtactctgtatagccgcctgtgagcttgttggtggccaagaatca
acagcaatgcctgctgcttgtggaatggagatgatacatgctatgtgtatgatgcacgac
gaccttccctgcatggacaacgatgatctccgtcgaggaaagctgtcacatcacaaggtt
tatggcgaaaatgtcactgttttagctggttattcccttgttgccttagcatttcagcat
atgacaacagccactaaaggtgtacacccgaaaacaatggctcgtgctgttggagaacta
gcaagattgataggtccagagggggcagcggctggccaggtgcttgacttgctgtgtgga
ggtaactctgatactggattagaagagctcgagtatattcatcgtcacaaaactgcagac
tttgcagaggctgcggccgttgtaggagcaatgattggtggtgcgtccgagaaggagatt
aatagacttgaaaaattctccaagtgtcttggactgctgtttcaggttgtggatgacatt
cttgatgtgactaaatcctctgagcaattaggaaagacagcggggaaggatttgttggct
aacaaattgacgtacccaaagatgattggcattgacaagtccaaagaatacgcccaaaaa
cttaacaaggaggccaaggaacaacttgtcggatttgatccagaaaagtcagctccatta
cttgctatggcagatttcgttcttcatcggcaaaaatga

DBGET integrated database retrieval system