KEGG   Solanum pennellii: 107011585Help
Entry
107011585         CDS       T04130                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 2 isoform X2
Organism
spen  Solanum pennellii
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung Pkinase_fungal TMEMspv1-c74-12 TPR_21 PRIMA1
Motif
Other DBs
NCBI-GeneID: 107011585
NCBI-ProteinID: XP_015066642
Position
1
AA seq 623 aa AA seqDB search
MEIPAPSILCNLFAIVLILHLLDTSVCEPRSQTATILCNTQLLHNWTIYVRNFVAAMETV
SQQMRNGGYGVAVSVTEPDTSYALAQCYGDLSLPDCALCYAEVRTILPQCFPHNGGRIYL
DGCFVRVETYTFYDQYLGPEDMHVCGNRTIKGTLFQQNARRAIQQAVVNAPTNNGYARAQ
VSGPGPSNATAYVLTDCWKTLSANSCAACLRNASESMLGCLPWSEDHHIAGKVVVIVVLS
SVVVLGVAVFIGFGVWKNKQIQKKRKGAADVEKLVKTLHKNNLNFKYSTLEKSTRSFEEA
NKLGQGGFGTVYKGVLADGKEIAVKRLFFNNKHRAADFCNEVNIISSIQHKNLTRLLGYS
CSGPESLLVYELLPNQSLDRFIFDPIKGKALNWEKRFEIIIGTAEGMVYLHENTNTRIIH
RDIKASNILLDSRLRAKIADFGLVRSFQEDKSHISTAVAGTLGYMAPEYLARGQLTEKAD
VYSFGVLLLEIVTGRQNNKRNNNEYTVSLVSDVWEHYKRGMVEELFDPNLMLHNYHTINV
RNEVARVLHVGLLCTQEIPTLRPSMSKALQMFIKKDEELPPPTKPPFVEEKPIETHNPQE
KYSIKEGAFATIANLSHSSFYPR
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggagataccagccccttcaattttatgtaacctctttgctattgtgttgatcctacat
ttactagatacatcagtgtgtgaaccaagatcgcagaccgccacgatcttatgtaacact
caactcctgcataattggacaatttatgtccgaaactttgttgcagctatggaaactgta
agccaacaaatgagaaatggaggatatggagttgcagtttctgtcactgaaccagatact
agctatgcacttgcccaatgctatggtgatctttctttacccgactgtgccttatgctat
gctgaagtgcgaacaattttgccccagtgcttccctcataacggagggcgaatttatctt
gatggatgctttgtgcgagtggagacttacacgttctatgaccagtatttaggcccagag
gatatgcatgtatgtggaaacaggacgataaagggtacattgttccaacagaacgctagg
cgagccattcagcaagcagttgtaaatgcaccgactaataatggctatgcacgtgctcaa
gtgtcagggccaggtccttctaatgcgacagcttatgttctcactgattgctggaagacg
ctgagcgcaaactcctgtgcagcgtgtttgcgaaatgcatctgaatccatgttgggatgc
ttaccttggtcagaagatcaccacattgcaggaaaagttgtagtcattgttgttcttagc
tccgttgtcgttttgggagtagctgtttttattggttttggtgtctggaagaacaaacaa
atccagaagaagagaaaaggtgcagctgatgttgagaagttagtgaagacccttcataaa
aacaacttgaacttcaagtattcgacacttgaaaaatccacgaggtcatttgaggaggcc
aacaagctcgggcaaggtggatttggcacggtttataagggtgttttggcagatgggaaa
gagatcgccgtcaaaaggctgttcttcaacaacaaacacagagctgcagatttttgtaac
gaggttaacataatcagtagcatccagcacaaaaatttgacaaggttattgggctacagc
tgctcaggaccggaaagcctacttgtatacgagttactccctaaccagagtctggatcgt
ttcatatttgaccctatcaaaggtaaagctctaaactgggagaagagatttgagataatt
atagggacagcagaaggaatggtatacctacacgagaacacaaatacacgaataattcac
agagacattaaggcaagcaacatcctgttggactcgaggctccgtgcaaagattgctgat
tttggattggtcaggtcattccaagaagacaagagtcacataagcactgccgttgctggc
accttaggatatatggctccagaatacttagcacgcggtcagctaacagaaaaggcagac
gtttacagctttggagttcttctactagagattgttactggaagacaaaacaacaagaga
aataacaatgaatatacagtcagcttagtttccgatgtgtgggagcattataaacgcggg
atggtggaggaactcttcgatccaaatctcatgttgcataactatcatactatcaatgta
agaaatgaggttgcgagagtgttacatgtgggacttttgtgcactcaagagatcccaacg
ttacgtccatccatgtctaaggcattacaaatgttcatcaagaaagatgaagagttgcct
cctcctactaagccgccattcgtggaagagaaacccattgaaactcacaaccctcaggag
aagtactcgataaaagaaggcgcttttgctacgattgccaacttatctcacagttcattt
taccccagatga

DBGET integrated database retrieval system