KEGG   Solanum pennellii: 107012102Help
Entry
107012102         CDS       T04130                                 

Definition
(RefSeq) non-specific phospholipase C6
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
spen  Solanum pennellii
Pathway
spen00562  Inositol phosphate metabolism
spen00564  Glycerophospholipid metabolism
spen00565  Ether lipid metabolism
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107012102
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107012102
   00565 Ether lipid metabolism
    107012102
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:spen02042]
    107012102
Enzymes [BR:spen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     107012102
Bacterial toxins [BR:spen02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   107012102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase DUF5338 Nic96
Motif
Other DBs
NCBI-GeneID: 107012102
NCBI-ProteinID: XP_015067325
Position
3
AA seq 525 aa AA seqDB search
MGHLRRKTPPFCYVLLIFLNLLWGFEDTYGEQKQPIKTVVVLVLENRSFDHLLGWMKKSV
NPRINGVTGKECNPLSTKAQHTQTICFTDDAQYVDPDPGHSFEDVEQQVFGSGSGSIPSM
SGFVEQALTMSDKNLSRAVMRGFKPENVPIYETLVREFAVFDRWFCSIPGPTQPNRLFLY
SATSHGSTSHVKKQLATGYPQKTIFDSLHENGLDFGIYYQNIPSTLFYRNLRMLKYMFKF
HQYDLKFKKDAKNGNLPNLTVIEPRYFGIIGYPANDDHPSHDVADGQKLVKEIYETLRAS
PQWNETLFVITYDEHGGFYDHVKTPYGDVPNPDGNTGPAPSFFKFDRLGVRVPTIMVSPW
IKKGTVITKPKGPTPNSEFEHSSIPATIKKIFNLSSNFLTHRDAWAGTFEHVVAQLSSPR
TDCPEVLPDASPLRSTTTEADETRALSEFQSEVVQLAAVLNGDHFLSSFPHEMGKKMNVK
EAHSYVGGAVSRFISASKEAIKLGADESTIVDMRSSLTTRTSVHH
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatttgagaagaaagactccacctttttgctatgttctcttgatttttctaaat
cttttgtggggttttgaggatacttatggagaacaaaaacaacccattaaaactgttgtt
gtgttggttttggagaatagatcttttgatcatttgcttggatggatgaagaaatcagtg
aatccaagaatcaatggtgttactggaaaagagtgtaatccattgtctactaaagcccaa
catactcaaacaatttgctttactgatgatgcacagtatgtggatccagaccctggtcac
tcttttgaagatgtggaacaacaggtgtttggctctggttctggctctattccatcaatg
tcaggttttgtggaacaagcactcactatgtctgataagaatctatcaagagctgtgatg
aggggatttaagccggaaaatgtcccaatttacgagacattagttcgcgaattcgcggta
tttgacagatggttttgttcaattccaggcccaacacaaccaaacaggctatttctatac
tctgcaacttctcatggttccacaagccatgtgaagaagcagttagctacagggtatcca
cagaaaaccatattcgattcgttacacgaaaacggattagattttggtatttactatcaa
aacataccatcaactctgttttacagaaatctaaggatgttgaagtacatgtttaagttt
catcagtatgatttgaagttcaagaaagatgctaaaaatggtaacttgcctaatttgaca
gtgattgagccaaggtatttcggtataatcggatatccagcaaatgatgatcatccatca
catgatgttgctgatggacagaaattagttaaggagatttatgagacattgagagctagc
cctcagtggaatgagacactttttgttataacttatgatgaacatggtggattttatgat
catgttaaaactccttatggtgatgttccaaatccagatggaaatactgggcctgcacct
tctttctttaagtttgatcggcttggtgttcgtgttccaacgattatggtctctccttgg
atcaagaaaggaactgtaataaccaagcctaagggacctacaccaaattccgaattcgaa
cactcatcgattccagcaacaataaagaaaatattcaatctttcatcgaattttctaact
catagagatgcttgggctggcacatttgaacatgttgtagctcaattgtcatctcccaga
actgattgccctgaggttctacctgatgcatctcctttgagaagcactactactgaagct
gatgaaactcgggcattgtccgagtttcagagcgaagtagtgcaattagcagctgtgttg
aatggggaccattttttgagcagttttccacatgaaatggggaagaaaatgaatgtaaaa
gaagctcatagctatgtaggaggtgcagtttcaagatttattagtgcaagtaaagaagct
attaaattaggagcagatgagtctactattgtagatatgagatcttctcttactactaga
acttctgtacaccactag

DBGET integrated database retrieval system