KEGG   Solanum pennellii: 107014317Help
Entry
107014317         CDS       T04130                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
spen  Solanum pennellii
Pathway
spen00051  Fructose and mannose metabolism
spen00520  Amino sugar and nucleotide sugar metabolism
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Module
spen_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    107014317
   00520 Amino sugar and nucleotide sugar metabolism
    107014317
Enzymes [BR:spen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     107014317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Fucokinase CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 107014317
NCBI-ProteinID: XP_015069659
Position
3
AA seq 415 aa AA seqDB search
MGSSEEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLAGQPMVHHPISACKKIPNLAQIY
LVGFYEEREFAIYVSSISNELRIPVRYLKEDKPHGSAGGLYNFRDLLMEDSPSHIFLLNC
DVCCSFPLPEMLEAHRRYGGMGTILVSKVSAETASEFGELVADPVTNELLHYTEKPETFV
SDRINCGVYVFTPDIFNAIQGVSTQRKDRANLRRVSSFEALQPVNRSLPTDFVRLDQDIL
TPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQYSSTSPHLLASGDGSKTATISGD
VYIHPSAKVHPTAKIGPNVSISANARIGAGARLISCIILDDVEIKENAVVIHAIVGWKSS
IGRWSRVQGVGDYNAKLGITILGESVSVEDEVVVINSIVLPNKTLNVSVQEEILL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgggaagttctgaggagaaagttgtggctgtgatcatggtcggtggaccaaccaaaggt
acacgtttccgcccattgtcattgaatatcccaaagccactttttccattagcaggacag
ccaatggttcatcatccgatctctgcctgtaaaaagattccgaacctagcgcagatctac
ctcgttggcttctatgaggagcgtgaatttgctatatatgtgtcttcaatctcgaatgaa
ctaagaattcctgtcagatacctgaaggaggacaaaccacatggttcagctggaggtctt
tacaactttagggatctgcttatggaagacagcccgtcacatatatttttgctgaactgc
gacgtttgctgcagttttcctttgcctgagatgcttgaggctcatagaagatatggtgga
atgggaaccattcttgtcagcaaggtgtctgctgagacagccagtgagtttggagaactg
gtcgccgaccccgttaccaatgaactgttgcattacactgagaaacctgaaacttttgtg
agtgaccgcatcaactgtggtgtgtacgtatttacaccagatatcttcaatgctattcaa
ggagtatccactcagaggaaagacagagctaatctaaggcgtgtatccagctttgaagct
cttcagccagtaaataggagtcttccaacagactttgtacggttggatcaagatattttg
acccctcttgctgggaagaagcagctatatacctatgaaaccatggatttctgggaacaa
attaaaacaccagggatgtctctgaaatgctccggtctctacctggctcaatatagttcc
acatcaccacatcttttggcaagtggggatggctcaaagactgcaaccatcagcggtgat
gtttatatccatccatctgctaaagttcatcctactgcaaagattggtcctaatgtttca
atttctgctaatgctcgtattggagctggtgccaggctcatcagttgtattatccttgat
gatgttgaaatcaaggaaaatgcggttgttattcatgcaattgttggctggaagtcttca
attggcagatggtcaagagtccagggtgtaggagactacaacgcaaagctcgggatcaca
attcttggtgaatccgtgtcggtcgaggatgaagtagtagtgatcaacagcattgtcctg
ccaaacaagactcttaatgtgagtgtccaagaagagatcttactttaa

DBGET integrated database retrieval system