KEGG   Solanum pennellii: 107015315Help
Entry
107015315         CDS       T04130                                 

Definition
(RefSeq) flavonoid 3'-monooxygenase
  KO
K05280  flavonoid 3'-monooxygenase [EC:1.14.14.82]
Organism
spen  Solanum pennellii
Pathway
spen00941  Flavonoid biosynthesis
spen00944  Flavone and flavonol biosynthesis
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    107015315
   00944 Flavone and flavonol biosynthesis
    107015315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:spen00199]
    107015315
Enzymes [BR:spen01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.82  flavonoid 3'-monooxygenase
     107015315
Cytochrome P450 [BR:spen00199]
 Cytochrome P450, plant type
  CYP75 family
   107015315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 107015315
NCBI-ProteinID: XP_015071036
Position
3
AA seq 515 aa AA seqDB search
MAIFFLILHTIISSIILHFFLFSLFFRKRYPVPLPPGPKPWPIIGNIIQLGPKPHQSTAS
MARTYGPLMHLRMGFVDVVVAASASVAAQFLKKHDANFSSRPPNSGAKHMAYNYHDLVFA
PYGPRWRMLRKICSVHLFSTKALDDFRHVRQEEVRTLTRALANAGQNPIKLGQLLNVCTT
NALARVMLGKRVFADGTNGMDPQAEEFKLMVVEMMVLAGVFNIGDFIPALDWMDIQGVAG
KMKKLHARFDAFLTTILEEHKEKRVGESKEQGDLLNTLISLKNEEDDNGGKLTDTEIKAL
LLNLFIAGTDTSSSTVEWAIAELIRNPKILAQAQQEIDKVVGKNRLVMESDLAQLTYLEA
IVKETFRLHPSTPLSLPRIASESCEINGYFIPKGSTLLVNVWAIARDPNEWADPLEFRPE
RFLPGGEKPKVDVKGNDFEVIPFGAGRRICPGMSLGIRMVQLMTATLIHSFNWALPTGQL
PDKLNMEEAFGLTLQRADPLVVHPIPRLEAQVYGE
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctatatttttcttaatactacacactattatttcctctattattctacatttcttt
ctttttagtttattttttcgtaaacgttacccagtgccactcccacccggtccaaaacca
tggccaataatcggaaacataatccaattaggtccgaagccgcaccagtccactgcatca
atggcccgaacttacgggccactcatgcaccttcgcatggggttcgtggacgtggtggta
gcagcctcagcttcggtggcggctcaatttttgaaaaagcatgacgctaacttctcgagc
cgcccaccgaactctggggcgaaacacatggcttataattaccatgaccttgtttttgca
ccttacggaccacggtggcgtatgctaaggaaaatttgttctgttcatcttttttcaact
aaagctttagatgactttcgccatgtccgacaggaagaagtcagaacacttacacgcgcc
ttagcgaatgctggtcaaaatccaatcaaactagggcagctgttgaacgtgtgcaccacg
aatgcacttgcgcgtgtgatgctcgggaagcgggtattcgccgacggtactaacggcatg
gatccacaagcggaggagttcaagttaatggtggtggagatgatggttctcgccggtgtt
ttcaacatcggcgattttattccggcgcttgattggatggacatccaaggcgtagctgga
aaaatgaagaagctccacgcgcgtttcgacgcgttcttaaccacgatcctcgaagaacac
aaggaaaagcgagttggagaatcgaaggaacagggggatttgttgaacacgttgatctct
ttgaaaaatgaagaagacgataatggtggaaaacttactgatacagaaattaaagcttta
cttttgaacttatttatagctgggacagacacatcctctagcacagtggaatgggccatt
gcagagcttattcgtaacccgaaaatactggcccaggcccaacaggagatcgacaaagta
gttggaaagaaccggctcgttatggaatctgacctggcccaattgacttatttggaagcc
atagtcaaggaaacctttaggcttcatccatcaacacccctctccctccctagaattgca
tccgagagctgtgagatcaatggctacttcattccaaaaggctcgacacttctcgtcaac
gtttgggccattgctcgtgatccaaatgaatgggctgatccattagagttcaggcccgaa
agattcttgcccggaggtgaaaagcccaaagttgatgtaaaaggaaatgactttgaagta
attccgtttggtgctggtcgaagaatatgccccggaatgagtttgggtatccgcatggtc
cagttgatgactgcaactttgatccattcatttaactgggctttgcccactggacaattg
ccagataagttaaatatggaggaagcatttgggctgactttacaacgggctgatccatta
gtggtccacccgatcccccggttagaagcccaagtatacggtgagtga

DBGET integrated database retrieval system