KEGG   Solanum pennellii: 107015392Help
Entry
107015392         CDS       T04130                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
spen  Solanum pennellii
Pathway
spen00052  Galactose metabolism
spen00500  Starch and sucrose metabolism
spen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spen00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107015392
   00500 Starch and sucrose metabolism
    107015392
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107015392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 107015392
NCBI-ProteinID: XP_015071129
Position
3
AA seq 574 aa AA seqDB search
MGYVRSVWLGVFVFISIHSYGNIRLFEASSRVIQTPDHIYRTAYHFQPAKYWMNDPNGPV
IYMGIYHLFYQYNPYDAQTGNIVWGHSTSTDLVNWTPQPPALLPSEPYDFKGCFTGSTTL
LSGGKPAVLYTGLDFSGIQVQNLAVPKNVADPYLREWVKSPYNPLIAPNSVNKIDGQNFR
DPSTAWLNPDGNWRMVVGNQQNGSGIGLLYRSKNFIDWIQAENPLHFLNNSGMWECPDFF
PVSKISKNGLETSTIGPNVKHVFKASTPSTPITDYYTIGTYNPNKDIFIPDNKSLDIGLG
FRYDYGKFYASKTFFDSSTSRRILFGWVYESVNNLEINSMRGWAGLQGIPRRIWLHKSGN
QLLQWPIFEIEKLRMNPVIEDTTVLMPGSIREISGVNATQADVEMSFSAKTLENAEKWEA
NWTNPQLVCSIKGATVKGGLGPFGLLVLASKDMQEYTAIFFRIFKGDNNNFIVLMCSDQT
RSSLHLPSSDYDKTTYGVLLNVDPLQEKLSLRTLIDHSIVESFGGEGKACITARVYPTNL
AVDGATHLYVFNNGSQSVDISKLTAWSMKTAQIN
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgggatatgttagaagtgtttggcttggagtttttgtattcatttccattcatagctat
ggcaatattagactatttgaagcttcttctcgtgtcatacagacacccgatcacatatat
cgcactgcttatcattttcaacctgccaagtattggatgaatgatcctaatggaccagtg
atatacatggggatttaccatttgttctatcagtacaatccttacgatgcacaaacaggt
aacattgtatggggccattccacatccactgatctcgtcaactggactcctcagccgccg
gcgcttctcccatcagagccttacgatttcaaaggctgttttaccggttctacaactctt
ctctctggcggaaaaccggcagttctctacaccggcttagatttctccggtatccaggta
caaaatctagcagtccccaaaaatgtagctgacccgtaccttagagaatgggtaaaatca
ccttataatccattaatcgcaccgaattcggtgaacaaaattgatggacaaaatttcaga
gatccaagtactgcttggctaaatcctgacggaaattggagaatggtagttggaaatcaa
caaaacgggagcggaattgggttattgtatagaagcaaaaacttcattgattggattcaa
gctgaaaatccactgcattttttgaacaattctggaatgtgggaatgccctgattttttc
cctgtttcaaaaatcagtaaaaatggtctagaaacttccacaataggtccaaatgtgaaa
catgtattcaaggcaagtacaccaagtacaccaatcactgattactacacaattggtaca
tataatccgaataaggatatttttattccggataacaaatcacttgatattggattagga
tttcgatatgattatggtaaattttatgcatcgaaaacttttttcgatagttctactagt
aggaggattttatttggatgggtttatgaatcggttaataatcttgagattaatagtatg
agaggatgggctggtcttcaaggaattcctagaaggatttggcttcataaatctggaaat
cagctgcttcaatggccgatatttgaaattgaaaagcttcgaatgaatccagttattgaa
gatactacagtgcttatgccaggatcaatacgtgaaatttctggagtcaatgctacgcag
gcagatgtagaaatgtcattttcagctaaaacattggaaaatgcagagaaatgggaagca
aattggacaaatccacaactagtgtgtagcataaaaggtgcaacagtaaaaggtgggctt
ggcccatttgggttactagttttggcatctaaagacatgcaagagtatactgcaattttc
ttcagaatattcaaaggagataacaacaattttatagtcctaatgtgtagtgatcagacc
aggtcttccttacacttgccttctagtgattatgacaaaacaacttatggggtcttgttg
aatgtggatcctcttcaagaaaaattgtctctcaggactttgattgatcactcaatagtg
gagagctttggaggagaaggaaaggcttgcattacagctagggtttatccaactaattta
gcagtggatggtgcaacccatttatatgtcttcaataatggttcacagagtgttgacatc
tctaaattgactgcttggagcatgaaaacagctcaaatcaattga

DBGET integrated database retrieval system