KEGG   Solanum pennellii: 107016158Help
Entry
107016158         CDS       T04130                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK10
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
spen  Solanum pennellii
Brite
KEGG Orthology (KO) [BR:spen00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spen01001]
    107016158
   01009 Protein phosphatases and associated proteins [BR:spen01009]
    107016158
Enzymes [BR:spen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107016158
Protein kinases [BR:spen01001]
 Serine/threonine kinases: Other
  Wnk family
   107016158
Protein phosphatases and associated proteins [BR:spen01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107016158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C TetR_C_8 APH
Motif
Other DBs
NCBI-GeneID: 107016158
NCBI-ProteinID: XP_015072132
Position
1
AA seq 746 aa AA seqDB search
MPISVHAIGILFIRGIYRHAKLIYLFRQHLNTLFWVVFVFSFPYSSFVIVCSIAGMSFGV
GSGSSYHSGNGVGVGSPLQRSSSNKGGFLGSSANERPAHQVDYVEKDPKGRYVRYSEVLG
KGAFKTVYKAFDLLDGIEVAWSRVKVEDVLQSPDDLGKLYAEIHILKQLKHDNIMKFCDS
WVDDKKRTVNMITELFTSGNLRQYRKKYRSVDMKAIKTWARQILQGLDYLHSQNPPIIHR
DLKCDNIFVNGNHGEIKIGDLGLATIMEQPTVKSVIGTPEFMAPELYEEEYNELVDIYSF
GMCMLELVTFEYPYSECKNPAQIFKKVSSGVKPASLGKVTDPQIKGFIEKCLVPASQRLP
AKDLLKDPFLQFENLNGPIHSLLQSPYQSPRSLSSLKSAPHSMDVDSDCNQSVCTDSHCG
SPCAPTLEFQRFHQNNEFKLTGKKNDENSVSLTLRIKSPLGRVRNIHFNFYLYTDTALLV
AAEMVDQLKLDDHDVDFIADFIDYLIMKIVPSWKPSDYHSSGGRSQREEALQNYLTLSPL
PTTSNARQDHIPVLNMNNQISSTAHQVDEDKLYANSNGTSCRVTFASPSHLASVMDGESV
TSEVMGKISSLKNSFGFGDYFTCADVISKGSSGNLSEVDFMGLFHDECKSQGNGGDYLEC
TLTNGFGKNLEVTLTDTNRASKCMSLSSNCSFLSLVSKDEESELKLELDSIESVYRQCYQ
ELSRMKLEALEACRKRWITKKKLACN
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcagtgtacacgcgatcggcattctatttatccgaggcatttatcgacatgca
aagttgatatatttgtttaggcagcatttgaataccctgttttgggttgtctttgttttc
tcttttccttattcttcctttgttattgtttgctccattgccggaatgagtttcggggtt
ggatcaggatcttcttatcattccggaaatggagttggagttggaagccctctgcagcgt
tcttccagtaacaaaggcggatttttaggttcatcggctaatgagcgaccggctcaccaa
gttgattatgtagagaaagaccccaagggtcgatatgttcggtacagtgaagtgttgggc
aagggagcattcaaaactgtctacaaggcgtttgacttacttgatggtattgaagttgca
tggagccgagtgaaagttgaggatgttttgcagtcgcctgacgatttgggaaagttgtat
gcggagattcatattcttaaacagttgaagcatgacaatataatgaagttctgtgattca
tgggttgatgacaagaagagaacagttaacatgatcactgaactcttcacatctgggaac
ctgaggcaataccgtaagaagtatagaagtgttgatatgaaggcaataaagacttgggca
aggcagatacttcaagggttagactatcttcatagtcagaaccctcctatcatccacagg
gatttgaaatgtgacaacatatttgtcaatggaaatcatggagaaattaagattggggac
cttggattggctaccattatggagcagcctactgttaagagtgttattgggaccccggaa
tttatggccccggagctttacgaagaagaatacaatgaactagtagacatatattccttt
ggaatgtgtatgttggaattagtaacctttgaatatccttacagtgaatgcaaaaatcct
gctcaaatatttaagaaagttagctcgggtgttaaacctgcttccctcggcaaagttact
gatccccaaatcaaaggtttcatcgagaaatgcctggttcctgcttctcagaggttgcct
gccaaggaccttctcaaagatccgtttcttcaatttgagaatttaaacgggccaatccat
agtctgttgcaatcaccttaccaaagtccaagatcattaagttcattgaaatctgcacct
cattcgatggatgtagattccgattgtaaccaatcagtatgtacagactcccattgtgga
agtccttgtgctccaacattggagttccagaggtttcatcagaataatgaatttaaattg
acgggtaagaagaatgatgagaactcagtttcattgaccttgcggattaaaagccctttg
ggcagagtaaggaatatacacttcaatttctatctctatacggacactgcactcttagtt
gcggctgagatggttgatcaattgaaactagatgatcatgatgtagattttattgccgac
ttcattgactatctaataatgaaaattgtgcctagttggaagccttcagattatcattct
agcggagggagaagtcaaagagaagaggctctacagaactacctaaccttgtctccctta
cctaccacatccaatgctcgacaagatcatattccagttctcaatatgaataaccagatt
agcagcactgctcatcaagttgatgaagataaactgtatgctaattcaaatggaacttct
tgtcgtgttacttttgcttccccttcacatttggcaagtgtgatggatggagagtctgtt
acttctgaagttatgggaaagatttcatctctaaaaaattcatttggatttggcgattac
tttacatgtgcagatgtaatctctaaaggttctagtggaaacttatcggaggtggatttc
atgggcttgtttcacgatgaatgcaagtcacagggaaatggtggcgattatttagaatgc
acgttaacaaatggatttggaaagaatctggaggtgaccttgacagatacaaatagagct
tctaaatgcatgagtttatcaagcaactgttcatttttatcgttagtatcgaaagatgag
gagagtgagttgaagttggagcttgactcaattgaatcagtatatcgacaatgctatcaa
gaactctcaagaatgaagctggaggcattagaagcttgcaggaagagatggatcacaaag
aaaaagttggcatgtaattaa

DBGET integrated database retrieval system