KEGG   Solanum pennellii: 107019771Help
Entry
107019771         CDS       T04130                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED6, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
spen  Solanum pennellii
Pathway
spen00906  Carotenoid biosynthesis
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Module
spen_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    107019771
Enzymes [BR:spen01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     107019771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 107019771
NCBI-ProteinID: XP_015075630
Position
5
AA seq 540 aa AA seqDB search
MQTIKPLNSPFSCKILINPSKKNTITLPRTRISSPSPPPSQSSSNSDESKIFPLKIDPPK
LNLFQKIASNALDLLENSIVTKFEKKHKLNRTVDPEIQLEGNFAPVHESPVQHGLEVVGH
IPSNLTGVYVRNGANPLFEPINGHHLFDGDGMIHAVKLDSKNNKASYSCRFTQTSRLVQE
ASLGRPVFPKPIGELHGHLGLARLALFFARASLGLVDATKGTGVANAGLVYFNGRLLAMS
EDDLPYNVIIKEDGDLESNGRYDFNGQINDPLIAHPKVDPITGEFYTLSYNILKKPYLKL
FKFDTCGNNSRDISISLQNPSMIHDFAITESHVIIPDYQVVFKLSEMIRGGSPVVHDPNK
VSRFGVLSKDDHDESRIKWIDVPSCFCMHLWNAWEENHEESGRSTRRIIVSGMNLEAGQV
NKTRLGKKTRYTFMAIAEPWPKCSGLAKIDLVTGNVTKFLHGDDRFGGEPYFVPSTKEGE
EDEGYLMSYVRDERNEKSELIIINAKNMKQIALVKIPKRVPYGFHGTFVSSQDLCNQFSC
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactatcaaacccctcaattctccattttcttgcaaaattctcatcaacccttct
aaaaaaaacacaataactcttcctagaacacgaatttcatcaccatcaccaccaccgtca
caatcatcgtcaaattcagatgaatcaaaaatatttccactaaaaattgacccgcccaaa
ttaaacctatttcaaaaaattgcatccaatgctttggacttactagaaaactcaattgta
acaaagtttgaaaaaaaacataagctgaaccggacggttgacccggaaattcaactagaa
gggaattttgcaccggttcatgaatccccggttcagcacggtcttgaagttgtgggtcac
attccgtctaatttaaccggagtctacgttagaaacggtgcgaacccgttattcgaaccg
attaacggacatcatttatttgacggtgacggtatgattcacgccgttaaattagattcg
aaaaataataaagctagttactcgtgccggttcactcaaaccagccggttggttcaagag
gcttcattgggccggccggtttttcctaagccaattggcgaattacatggccatttaggg
ttagctcggctcgcgctattttttgcgcgagcgagtttagggttagtggatgctactaaa
ggaaccggtgtagcaaatgccggtttggtttattttaacggtcgacttttagctatgtca
gaggatgatcttccgtataacgttattatcaaggaggatggcgatctagagtctaacgga
cgttacgattttaacggacaaattaatgatccattgatagcacatcctaaagtggaccct
atcacaggggaattttatactttgagttataatatattaaaaaaaccttatcttaaatta
ttcaaatttgacacgtgtggtaataattcacgtgacatttctatttccctccaaaaccca
tccatgatccatgattttgccatcacggaaagtcacgtgatcattccggattatcaagtg
gtattcaagttatccgagatgatacggggcgggtcgcccgtagtccacgacccgaataaa
gtatctaggtttggtgtgttgtcgaaagacgaccacgacgaatcaagaatcaagtggatt
gatgttcctagttgcttttgcatgcatttgtggaacgcgtgggaggagaatcatgaagaa
tcaggaagatcaaccagacggattatagtatcagggatgaatttagaagcgggacaagtc
aacaagactagacttggtaaaaaaactcggtataccttcatggctatagccgaaccatgg
ccaaaatgtagtggcctagcgaaaatcgatttggtcacaggaaatgtcacaaaattttta
catggagatgacagattcgggggtgaaccttatttcgtaccgagcacgaaagaaggagaa
gaagatgaagggtaccttatgagttatgttcgagatgaaagaaatgaaaaatcagaatta
attataattaatgctaaaaatatgaagcaaatcgccttagtaaaaatacctaaaagagtg
ccatatggctttcatggtacattcgttagttcacaagatttatgtaatcaattttcttgt
taa

DBGET integrated database retrieval system