KEGG   Solanum pennellii: 107020361Help
Entry
107020361         CDS       T04130                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
spen  Solanum pennellii
Pathway
spen00010  Glycolysis / Gluconeogenesis
spen00562  Inositol phosphate metabolism
spen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107020361
   00562 Inositol phosphate metabolism
    107020361
Enzymes [BR:spen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107020361
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107020361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 107020361
NCBI-ProteinID: XP_015076176
Position
5
AA seq 513 aa AA seqDB search
MYYNRKNSKEEMLKNSMNFAPLLLLQLLLIAIAVQYSTADESFDVRQHLSTVSRYGIVKD
IADDSFVPSLNLDQCTPIHLNLVARHGTRAPTKKRIRELEAFAIRLEVLVRDVKEQKQSL
DKIPAWLMGWNSPWKGKSTGGELISEGEDELYHLGIRVREQFPSLFSEEYHPAIYSIKAT
QVPRASASAVAFGMGLFSGKGKLGPGGHRAFAVTSESRASDTVLRFHDCCQSYKDFRRSQ
EPTVKKLKEPILDEITHELVKQYGLNFTKQDVSSLWFLCKQEASLLNITNQACSLFSPAE
VSLLEWADDLELFILKGYGNSLNYRMGVPLLEDVIQSMEQAIKAKEEGYAPGSYEKARLR
FAHAETLLPFSCLIGLFLEESEFELIQREQTLQYPPKPPKTRNWRGNLVAPFAGNNMLVL
YSCTSDNSSKYFVKVLHNERPIPIPGCNGSDSCPFEVFKERIAAPHLKHDYNSLCNVNSE
QEKKDSSPSMFSQMFGWIFSQKNSDTPTQKVEL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtactacaataggaagaactcgaaagaagaaatgttgaagaactccatgaattttgct
ccgttactgctccttcaacttctactcattgcaattgcagtacaatactcaaccgctgat
gaatccttcgatgttcgtcaacatctatcaactgtatcgaggtatggtattgtgaaggat
atagctgatgattcctttgttccttccctaaatctcgatcagtgtacacctattcatttg
aatcttgtggcgcggcatggaactcgtgctcctacaaagaaaagaatcagggagctagaa
gcctttgctattcgattagaagtccttgtacgtgatgttaaggaacagaagcagtctttg
gataaaattcctgcttggttaatggggtggaactctccttggaagggcaaaagtacaggc
ggagagttgatcagcgaaggagaagatgagttatatcatcttggtatcagagtcagagaa
cagtttcccagcctgtttagtgaagaataccaccctgctatatattcaatcaaggctacc
caggttcctcgggcatcagctagcgctgtggcatttggcatgggtctgtttagtggaaaa
gggaagcttggaccaggaggtcatcgagcttttgctgttacaagtgaaagccgtgcaagt
gatacagttttgagatttcatgattgttgtcaaagttacaaggattttaggagaagtcag
gaaccaactgtaaagaagctcaaagaacctatattagatgaaattactcatgaactagtg
aagcaatatgggcttaattttacaaagcaggatgtatcttctctatggtttttatgcaag
caggaagcttcactgttgaacatcaccaatcaagcttgtagtctattcagtccagcagag
gtttctttactggaatgggccgacgatttggagttattcatactaaagggctatggtaat
tcactaaattaccgaatgggagtgccgctacttgaggatgtgattcaatccatggaacag
gcaattaaggctaaagaagaaggatatgctcccgggagctatgaaaaagcaagactacgt
tttgctcatgcagaaactctgcttcctttttcatgcttgattggactctttcttgaagaa
tctgaatttgaactaatacaaagagagcagacgttgcaataccctcctaagcctcctaaa
acaagaaactggcggggaaatttggtggcaccttttgctggaaataacatgctagtcctt
tacagctgcacgtcagacaactcaagcaagtattttgttaaagtgctccacaatgaacgg
cccattccaataccaggttgcaatggctcggattcatgcccatttgaagtatttaaggaa
agaatagctgctcctcacttgaaacatgactacaattctctttgcaatgtgaattcagaa
caagaaaagaaggattcttctcccagtatgttctcacaaatgtttggttggattttctca
cagaagaactctgatacacccacacagaaggttgagctataa

DBGET integrated database retrieval system