KEGG   Solanum pennellii: 107021044Help
Entry
107021044         CDS       T04130                                 

Definition
(RefSeq) mitogen-activated protein kinase 3-like
  KO
K20536  mitogen-activated protein kinase 3 [EC:2.7.11.24]
Organism
spen  Solanum pennellii
Pathway
spen04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:spen00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107021044
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spen01001]
    107021044
Enzymes [BR:spen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107021044
Protein kinases [BR:spen01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107021044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 107021044
NCBI-ProteinID: XP_015077099
Position
6
AA seq 373 aa AA seqDB search
MVDANMGAAQFPDFPKIVTHAGQYVQYDIFGNLFEITNKYQPPIMPIGRGAYGIVCSVFN
AELNEMVAVKKIANAFDNYMDAKRTLREIKLLRHLDHENVIGLRDVIPPPLRREFSDVYI
ATELMDTDLHQIIRSNQGLSEDHCQYFMYQLLRGLKYIHSAHVIHRDLKPSNLLLNANCD
LKICDFGLARPNVENENMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKP
LFAGKDHVHQIRLLTELLGTPTESDLSFLRNEDAKRYVRQLPQHPRQQLATVFPHVNPLA
IDLVDKMLTLDPTRRITVEEALAHPYLAKLHDAADEPVCPIPFSFDFEQQGIGEEQIKDM
IYQEALALNPEYA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgctaatatgggtgctgctcaatttcctgattttcctaaaattgtcactcat
gctggacaatatgttcagtatgacatttttggtaatctttttgagattactaacaagtat
caacctcctatcatgcctattggacgtggcgcttatggaatcgtctgctctgtgtttaat
gcggagctgaatgagatggttgcagttaagaaaatcgccaatgcttttgataattacatg
gatgctaagaggacgctccgtgaaattaagcttcttcgccatttagaccatgaaaacgtc
attggtttaagagatgtgattcctccgcccttacgaagggagttttctgatgtttacatt
gctactgaactcatggatactgatcttcaccaaataattagatcaaaccaaggtttatca
gaggatcattgccagtacttcatgtatcagcttctccgtgggctaaagtacatacattcc
gcgcatgttattcatagagatctcaaaccaagtaacctcttgctaaatgcaaattgtgat
cttaagatatgtgattttggtcttgcaaggccaaatgtagagaacgagaatatgacagaa
tatgtagtaaccagatggtacagggcaccggagcttttgttgaactcttcagattacact
gctgccatagatgtttggtctgtgggttgcatcttcatggagcttatgaatagaaaacct
ttgtttgctggaaaagatcatgtacatcaaatacgcttgctaactgagcttcttggaact
cctacagaatctgatcttagcttcctccgtaatgaagatgcaaaaagatacgtcaggcaa
ctcccacaacatccacgccagcagttagcaacagtgttccctcatgtgaatccattagcc
attgatcttgtagataagatgttgacgctcgaccctactagaagaataacagttgaggaa
gcattagctcatccctacctcgcaaagctccatgatgcagctgatgaaccagtctgcccc
atcccgttctctttcgactttgagcaacaagggataggagaagagcagattaaagacatg
atttatcaagaagctttggcgttgaatcctgaatatgcttaa

DBGET integrated database retrieval system